Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTYDSVG)

• DTT Name: Syndecan-1 (SDC1)
• Synonyms: SYND1; SDC; CD138
• Gene Name: SDC1
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Peptide translocating syndecan
• UniProt ID: SDC1_HUMAN
• TTD ID: T13017
• Sequence:
  MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQ
  TPSTWKDTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQE
  ATPRPRETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHT
  EDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGAT
  GASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQ
  KPTKQEEFYA
• Function: Regulates exosome biogenesis in concert with SDCBP and PDCD6IP. Cell surface proteoglycan that bears both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix.
• KEGG Pathway:
  ECM-receptor interaction (hsa04512)
  Cell adhesion molecules (hsa04514)
  Malaria (hsa05144)
  Proteoglycans in cancer (hsa05205)
  Fluid shear stress and atherosclerosis (hsa05418)
• Reactome Pathway:
  HS-GAG biosynthesis (R-HSA-2022928)
  HS-GAG degradation (R-HSA-2024096)
  Cell surface interactions at the vascular wall (R-HSA-202733)
  Syndecan interactions (R-HSA-3000170)
  Defective B4GALT7 causes EDS, progeroid type (R-HSA-3560783)
  Defective B3GAT3 causes JDSSDHD (R-HSA-3560801)
  Defective EXT2 causes exostoses 2 (R-HSA-3656237)
  Defective EXT1 causes exostoses 1, TRPS2 and CHDS (R-HSA-3656253)
  Defective B3GALT6 causes EDSP2 and SEMDJL1 (R-HSA-4420332)
  Other interleukin signaling (R-HSA-449836)
  Attachment and Entry (R-HSA-9694614)
  Retinoid metabolism and transport (R-HSA-975634)
  A tetrasaccharide linker sequence is required for GAG synthesis (R-HSA-1971475)

Molecular Interaction Atlas (MIA) of This DTT

5 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
BT-062	DMYO185	Multiple myeloma	2A83	Phase 2	[1]
CART-138 cells	DMB4HEW	Multiple myeloma	2A83	Phase 1/2	[2]
CD138 CAR T cells	DMCSGNU	Multiple myeloma	2A83	Phase 1/2	[3]
CAR138 T Cells	DMA9M81	Immune System disease	4A01-4B41	Phase 1	[4]
CAR-T cells targeting CD138	DMHBQYU	Multiple myeloma	2A83	Clinical trial	[5]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Multiple myeloma	2C82	Bone marrow	1.62E-03	0.76	2.17

References

• [1] The monoclonal antibody nBT062 conjugated to cytotoxic Maytansinoids has selective cytotoxicity against CD138-positive multiple myeloma cells in vitro and in vivo. Clin Cancer Res. 2009 Jun 15;15(12):4028-37.
• [2] ClinicalTrials.gov (NCT01886976) Treatment of Chemotherapy Refractory Multiple Myeloma by CART-138
• [3] ClinicalTrials.gov (NCT03271632) Multi-CAR T Cell Therapy in the Treatment of Multiple Myeloma
• [4] ClinicalTrials.gov (NCT03672318) Study of ATLCAR.CD138 Cells for Relapsed/Refractory Multiple Myeloma
• [5] ClinicalTrials.gov (NCT03473496) CAR-T Cells Therapy in Relapsed/Refractory Multiple Myeloma