Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTYLQ8V)

• DTT Name: Prostaglandin E synthase (PTGES)
• Synonyms: p53-induced gene 12 protein; PIG12; PGES; PGE synthase; P53-induced apoptosis protein 12; Microsomal prostaglandin E synthase 1; Microsomal glutathione S-transferase 1-like 1; MPGES1; MPGES-1; MGST1L1; MGST1-L1
• Gene Name: PTGES
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Intramolecular oxidoreductase
• UniProt ID: PTGES_HUMAN
• TTD ID: T02562
• EC Number: EC 5.3.99.3
• Sequence:
  MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
  SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
  LRAPIRSVTYTLAQLPCASMALQILWEAARHL
• Function: Catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2).
• KEGG Pathway:
  Arachidonic acid metabolism (hsa00590)
  Metabolic pathways (hsa01100)
• Reactome Pathway: Synthesis of Prostaglandins (PG) and Thromboxanes (TX) (R-HSA-2162123)
• BioCyc Pathway: MetaCyc:HS07518-MON

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AAD-2004	DMG4RK0	Alzheimer disease	8A20	Phase 1	[1]

31 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Alpha-substituted pirinixic acid and pirinixic acid ester derivative 1	DMWX0QK	N. A.	N. A.	Patented	[2]
Benzamide derivative 14	DMP2LDC	N. A.	N. A.	Patented	[2]
Benzamide derivative 15	DMAEBJ4	N. A.	N. A.	Patented	[2]
Benzamide derivative 16	DMOAXKF	N. A.	N. A.	Patented	[2]
Benzamide derivative 18	DMD7640	N. A.	N. A.	Patented	[2]
Benzimidazole derivative 11	DMGRD8B	N. A.	N. A.	Patented	[2]
Benzimidazole derivative 12	DMOHERV	N. A.	N. A.	Patented	[2]
Benzimidazole derivative 13	DMV4DQI	N. A.	N. A.	Patented	[2]
Benzimidazole derivative 14	DMCY5M7	N. A.	N. A.	Patented	[2]
Benzimidazole derivative 15	DMJ3AZ4	N. A.	N. A.	Patented	[2]
Benzimidazole derivative 16	DMHEQDT	N. A.	N. A.	Patented	[2]
Benzimidazole derivative 17	DM1DXME	N. A.	N. A.	Patented	[2]
Betais-sulfonylamino derivative 1	DMMCDR7	N. A.	N. A.	Patented	[2]
Boswellia acid derivative 1	DMCLB5D	N. A.	N. A.	Patented	[2]
Carboxylic acid derivative 1	DM86E2P	Angiogenesis disorder	BE2Z	Patented	[2]
Imidazole benzamide derivative 1	DM0SOKJ	Knee pain	ME82	Patented	[2]
Imidazopyridine derivative 5	DMUKBGD	N. A.	N. A.	Patented	[2]
Imidazopyridine derivative 6	DMA0V4F	N. A.	N. A.	Patented	[2]
Imidazopyridine derivative 7	DMI3XPJ	N. A.	N. A.	Patented	[2]
Methyl-piperidine compound 1	DM5PS6K	Angiogenesis disorder	BE2Z	Patented	[2]
Phthalazinone derivative 1	DMNA941	N. A.	N. A.	Patented	[2]
Piperidine carboxamide derivative 1	DMY8QIG	N. A.	N. A.	Patented	[2]
PMID28627961-Compound-22	DM36P7T	N. A.	N. A.	Patented	[2]
PMID28627961-Compound-30	DMRLU8I	N. A.	N. A.	Patented	[2]
PMID28627961-Compound-31	DMLGYXW	N. A.	N. A.	Patented	[2]
PMID28627961-Compound-32	DM5IZKD	N. A.	N. A.	Patented	[2]
PMID28627961-Compound-33	DMWV4YE	N. A.	N. A.	Patented	[2]
PMID28627961-Compound-41	DMODL3P	N. A.	N. A.	Patented	[2]
PMID28627961-Compound-44	DM7ATLP	N. A.	N. A.	Patented	[2]
Polycyclic compound 1	DMSWI67	N. A.	N. A.	Patented	[2]
Pyrimidine derivative 2	DMS8OR3	N. A.	N. A.	Patented	[2]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
L-655240	DMGX3MK	N. A.	N. A.	Terminated	[3]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Alzheimer's disease	8A00.0	Entorhinal cortex	7.92E-02	-0.05	-0.24

References

• [1] Concurrent blockade of free radical and microsomal prostaglandin E synthase-1-mediated PGE2 production improves safety and efficacy in a mouse model of amyotrophic lateral sclerosis. J Neurochem. 2012 Sep;122(5):952-61.
• [2] Microsomal prostaglandin E2 synthase-1 inhibitors: a patent review.Expert Opin Ther Pat. 2017 Sep;27(9):1047-1059.
• [3] Inhibitors of the inducible microsomal prostaglandin E2 synthase (mPGES-1) derived from MK-886. Bioorg Med Chem Lett. 2005 Jul 15;15(14):3352-5.