Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTYXPCO)

DTT Name	P2Y purinoceptor 11 (P2RY11)
Synonyms	P2Y11
Gene Name	P2RY11
DTT Type	Discontinued target	[1]
Related Disease	Lung cancer [ICD-11: 2C25]
UniProt ID	P2Y11_HUMAN
TTD ID	T92689
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRP WHPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFI TCISLNRYLGIVHPFFARSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNC SVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPGMTV AEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPY VGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATA APKPSEPQSRELSQ
Function	Receptor for ATP and ADP coupled to G-proteins that activate both phosphatidylinositol-calcium and adenylyl cyclase second messenger systems. Not activated by UTP or UDP.
KEGG Pathway	( )
Reactome Pathway	P2Y receptors (R-HSA-417957 ) G alpha (s) signalling events (R-HSA-418555 ) ADORA2B mediated anti-inflammatory cytokines production (R-HSA-9660821 ) G alpha (q) signalling events (R-HSA-416476 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
INS 316	DMTHMEI	Lung cancer	2C25.0	Discontinued in Phase 3	[1]
------------------------------------------------------------------------------------

8 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
2MeSATP	DMUE0W6	Discovery agent	N.A.	Investigative	[2]
ATPgammaS	DMXHQIN	Discovery agent	N.A.	Investigative	[2]
BzATP	DM37GYA	Discovery agent	N.A.	Investigative	[2]
dATP	DMMXFBJ	Discovery agent	N.A.	Investigative	[2]
NAADP	DM51DW6	Discovery agent	N.A.	Investigative	[3]
NF157	DMGMH8T	Discovery agent	N.A.	Investigative	[4]
NF340	DMPSXR8	Discovery agent	N.A.	Investigative	[5]
NF546	DMPZB31	Discovery agent	N.A.	Investigative	[6]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Investigative Drug(s)

References

1	Characterization of a Ca2+ response to both UTP and ATP at human P2Y11 receptors: evidence for agonist-specific signaling. Mol Pharmacol. 2003 Jun;63(6):1356-63.
2	Pharmacological characterization of the human P2Y11 receptor. Br J Pharmacol. 1999 Nov;128(6):1199-206.
3	NAADP+ is an agonist of the human P2Y11 purinergic receptor. Cell Calcium. 2008 Apr;43(4):344-55.
4	Synthesis and structure-activity relationships of suramin-derived P2Y11 receptor antagonists with nanomolar potency. J Med Chem. 2005 Nov 3;48(22):7040-8.
5	Invited Lectures : Overviews Purinergic signalling: past, present and future. Purinergic Signal. 2006 May;2(1):1-324.
6	NF546 [4,4'-(carbonylbis(imino-3,1-phenylene-carbonylimino-3,1-(4-methyl-phenylene)-carbonylimino))-bis(1,3-xylene-alpha,alpha'-diphosphonic acid) tetrasodium salt] is a non-nucleotide P2Y11 agonist and stimulates release of interleukin-8 from human monocyte-derived dendritic cells. J Pharmacol Exp Ther. 2010 Jan;332(1):238-47.