Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTZ963I)

DTT Name Monoglyceride lipase (MAGL)
Synonyms Monoacylglycerol lipase; MGL; Lysophospholipaselike; Lysophospholipase-like; Lysophospholipase homolog; HUK5; HU-K5
Gene Name MGLL
DTT Type
Clinical trial target
 [1]
BioChemical Class
Carboxylic ester hydrolase
UniProt ID
MGLL_HUMAN
TTD ID
T18664
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
EC 3.1.1.23
Sequence
MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEE
LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLG
HSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPID
SSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADR
LCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTA
SPP
Function
Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth. Converts monoacylglycerides to free fatty acids and glycerol.
KEGG Pathway
Glycerolipid metabolism (hsa00561 )
Metabolic pathways (hsa01100 )
Retrograde endocannabinoid signaling (hsa04723 )
Reactome Pathway
Hormone-sensitive lipase (HSL)-mediated triacylglycerol hydrolysis (R-HSA-163560 )
Acyl chain remodeling of DAG and TAG (R-HSA-1482883 )
BioCyc Pathway
MetaCyc:HS01140-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
ABX-1431 DM9SYVJ Neuropathic pain 8E43.0 Phase 1 [1]
------------------------------------------------------------------------------------
45 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Azetidine-benzoxazin-3(4H)-one derivative 1 DMRMED4 N. A. N. A. Patented [2]
Azetidine-benzoxazin-3(4H)-one derivative 2 DMMSPX7 N. A. N. A. Patented [2]
Azetidine-benzoxazin-3(4H)-one derivative 3 DMA430E N. A. N. A. Patented [2]
Azetidinyl-piperazine derivative 1 DMMWK3E N. A. N. A. Patented [2]
Azetidinyl-piperazine derivative 2 DM0C48S N. A. N. A. Patented [2]
Azetidinyl-piperazine derivative 3 DM3WHL2 N. A. N. A. Patented [2]
Azetidinyl-piperidine derivative 1 DM0IJYQ N. A. N. A. Patented [2]
Azetidinyl-piperidine derivative 2 DMNQLJU N. A. N. A. Patented [2]
Azetidinyl-piperidine derivative 3 DM2UDV8 N. A. N. A. Patented [2]
Carbamate derivative 10 DMP98CL N. A. N. A. Patented [2]
Carbamate derivative 11 DM3CF91 N. A. N. A. Patented [2]
Carbamate derivative 12 DMMH27J N. A. N. A. Patented [2]
Carbamate derivative 13 DMLH45M N. A. N. A. Patented [2]
Carbamate derivative 14 DMZS0HT N. A. N. A. Patented [2]
Carbamate derivative 15 DMOKC41 N. A. N. A. Patented [2]
Carbamate derivative 16 DMPLZSE N. A. N. A. Patented [2]
Carbamate derivative 17 DMYSRPT N. A. N. A. Patented [2]
Carbamate derivative 9 DMW4B1U N. A. N. A. Patented [2]
Carbamide derivative 24 DMD6Y73 N. A. N. A. Patented [2]
Carbamide derivative 25 DM8ONCL N. A. N. A. Patented [2]
Carbamide derivative 26 DMDU9XF N. A. N. A. Patented [2]
Piperazine carbamic compound 1 DMZSYU4 N. A. N. A. Patented [2]
Piperazine carbamic compound 2 DMMQ0ZO N. A. N. A. Patented [2]
Piperazine carbamic compound 3 DM8IU1G N. A. N. A. Patented [2]
Piperazine carbamic compound 4 DMKZUO4 N. A. N. A. Patented [2]
Piperazine carbamic compound 5 DMXH65Z N. A. N. A. Patented [2]
PMID29053063-Compound-11c DMLMHR5 N. A. N. A. Patented [2]
PMID29053063-Compound-11d DMDRK68 N. A. N. A. Patented [2]
PMID29053063-Compound-14 DMBR72X N. A. N. A. Patented [2]
PMID29053063-Compound-15 DM07U5R N. A. N. A. Patented [2]
PMID29053063-Compound-17 DMRHPN0 N. A. N. A. Patented [2]
PMID29053063-Compound-4 DM8RAK0 N. A. N. A. Patented [2]
PMID29053063-Compound-5 DM2P05S N. A. N. A. Patented [2]
PMID29053063-Compound-7a DMTOHNQ N. A. N. A. Patented [2]
PMID29053063-Compound-7b DMDJ6O8 N. A. N. A. Patented [2]
PMID29053063-Compound-7c DMNZO7V N. A. N. A. Patented [2]
PMID29053063-Compound-7d DMUNXAR N. A. N. A. Patented [2]
PMID29053063-Compound-7e DM6XYFB N. A. N. A. Patented [2]
PMID29053063-Compound-7f DMIQ263 N. A. N. A. Patented [2]
Pyrazole derivative 80 DMQ3TGM N. A. N. A. Patented [2]
Pyrazole derivative 81 DMWT437 N. A. N. A. Patented [2]
Pyrazole derivative 82 DMETCI3 N. A. N. A. Patented [2]
Pyrazole derivative 83 DMMGLOA N. A. N. A. Patented [2]
Pyrazole derivative 84 DME8Q0F N. A. N. A. Patented [2]
Pyrazole derivative 85 DMNBCKI N. A. N. A. Patented [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 45 Patented Agent(s)
1 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
JZL184 DMWA8B0 Discovery agent N.A. Investigative [3]
------------------------------------------------------------------------------------

References

1 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
2 A patent review of Monoacylglycerol Lipase (MAGL) inhibitors (2013-2017).Expert Opin Ther Pat. 2017 Dec;27(12):1341-1351.
3 Selective blockade of 2-arachidonoylglycerol hydrolysis produces cannabinoid behavioral effects. Nat Chem Biol. 2009 Jan;5(1):37-44.