Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTZHKV9)

• DTT Name: Neurotrophin-3 (NTF3)
• Synonyms: Neurotrophic factor; Nerve growth factor 2; NT-3; NGF-2; HDNF
• Gene Name: NTF3
• DTT Type: Discontinued target; [1]
• BioChemical Class: Growth factor
• UniProt ID: NTF3_HUMAN
• TTD ID: T32855
• Sequence:
  MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQ
  STLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLM
  EDYVGSPVVANRTSRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIK
  TGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWI
  RIDTSCVCALSRKIGRT
• Function: Seems to promote the survival of visceral and proprioceptive sensory neurons.
• KEGG Pathway:
  MAPK signaling pathway (hsa04010)
  Neurotrophin signaling pathway (hsa04722)
• Reactome Pathway:
  NTF3 activates NTRK3 signaling (R-HSA-9034013)
  Signaling by NTRK3 (TRKC) (R-HSA-9034015)
  Activated NTRK3 signals through PLCG1 (R-HSA-9034793)
  Activated NTRK3 signals through RAS (R-HSA-9034864)
  Activated NTRK3 signals through PI3K (R-HSA-9603381)
  NTF3 activates NTRK2 (TRKB) signaling (R-HSA-9025046)

Molecular Interaction Atlas (MIA) of This DTT

2 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
NT-3	DMGZ3DR	Constipation	DD91.1	Discontinued in Phase 2	[1]
ReN-1826	DMGY51F	Central nervous system disease	8A04-8D87	Terminated	[2]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Irritable bowel syndrome	DD91.0	Rectal colon tissue	5.49E-01	-0.01	-0.05

References

• [1] NT-3. Takeda/Regeneron/Amgen. IDrugs. 2001 Jul;4(7):820-4.
• [2] Pulmonary distribution, regulation, and functional role of Trk receptors in a murine model of asthma. J Allergy Clin Immunol. 2006 Sep;118(3):597-605.