Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTZPLJS)

• DTT Name: Interleukin 11 receptor alpha (IL11RA)
• Synonyms: Interleukin-11 receptor subunit alpha; IL-11RA; IL-11R-alpha; IL-11R subunit alpha; IL-11 receptor subunit alpha
• Gene Name: IL11RA
• DTT Type: Successful target; [1]
• BioChemical Class: Cytokine receptor
• UniProt ID: I11RA_HUMAN
• TTD ID: T47610
• Sequence:
  MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWF
  RDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSC
  QAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARC
  VVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASW
  TYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLD
  AGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHR
  DSVEQVAVLASLGILSFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRRPGAP
  NL
• Function: The receptor systems for IL6, LIF, OSM, CNTF, IL11 and CT1 can utilize IL6ST for initiating signal transmission. The IL11/IL11RA/IL6ST complex may be involved in the control of proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells. Essential for the normal development of craniofacial bones and teeth. Restricts suture fusion and tooth number. Receptor for interleukin-11.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Jak-STAT signaling pathway (hsa04630)
  Hematopoietic cell lineage (hsa04640)
• Reactome Pathway: IL-6-type cytokine receptor ligand interactions (R-HSA-6788467)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Oprelvekin	DMTSRI6	Inflammatory bowel disease	DD72	Approved	[1]

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
UNI-rhIL-11	DM0DIEZ	Thrombocytopenia	3B64	Phase 3	[2]
BMTP-11	DMB6FMH	Prostate cancer	2C82.0	Phase 1	[3]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Prostate cancer	2C82	Prostate	4.98E-03	-0.2	-0.48
Thrombocytopenia	3B64	Whole blood	1.95E-01	0.44	0.53

References

• [1] Oprelvekin: a review of its pharmacology and therapeutic potential in chemotherapy-induced thrombocytopenia. BioDrugs. 1998 Aug;10(2):159-71.
• [2] Clinical study of rhIL-11 for prevention and treatment of chemotherapy-induced thrombocytopenia. Ai Zheng. 2002 Aug;21(8):892-5.
• [3] Targeting IL11 Receptor in Leukemia and Lymphoma: A Functional Ligand-Directed Study and Hematopathology Analysis of Patient-Derived Specimens. Clin Cancer Res. 2015 Jul 1;21(13):3041-51.