Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE2XQGW)

DME Name Lauric acid omega-hydroxylase (CYP4A11)
Synonyms Fatty acid omega-hydroxylase; Cytochrome P-450HK-omega; Cytochrome P450 4A11; Cytochrome P450HL-omega; 20-HETE synthase; 20-hydroxyeicosatetraenoic acid synthase; CYP4A11; CYP4A2; CYP4AII; CYPIVA11
Gene Name CYP4A11
UniProt ID
CP4AB_HUMAN
INTEDE ID
DME0029
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1579
EC Number EC: 1.14.15.3
Oxidoreductase
Oxygen paired donor oxidoreductase
Iron-sulfur protein donor oxidoreductase
EC: 1.14.15.3
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLF
GHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSY
RFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQD
SPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQND
TIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKM
ENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGDGAS
ITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHH
NPKVWPNPEVFDPFRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFEL
LPDPTRIPIPIARLVLKSKNGIHLRLRRLPNPCEDKDQL
Function
This enzyme is involved in the metabolism of fatty acids and their oxygenated derivatives (oxylipins). It catalyzes predominantly the oxidation of the terminal carbon (omega-oxidation) of saturated and unsaturated fatty acids, the catalytic efficiency decreasing in the following order: dodecanoic > tetradecanoic > (9Z)-octadecenoic > (9Z,12Z)-octadecadienoic > hexadecanoic acid. It acts as a major omega-hydroxylase for dodecanoic (lauric) acid in liver and participates in omega-hydroxylation of (5Z,8Z,11Z,14Z)-eicosatetraenoic acid (arachidonate) to 20- hydroxyeicosatetraenoic acid (20-HETE). It can also catalyze the oxidation of the penultimate carbon (omega-1 oxidation) of fatty acids with lower efficiency. Besides, it may contribute to the degradation of saturated very long-chain fatty acids (VLCFAs) such as docosanoic acid, by catalyzing successive omega-oxidations to the corresponding dicarboxylic acid, thereby initiating chain shortening.
KEGG Pathway
Arachidonic acid metabolism (hsa00590 )
Fatty acid degradation (hsa00071 )
Inflammatory mediator regulation of TRP channels (hsa04750 )
Metabolic pathways (hsa01100 )
PPAR signaling pathway (hsa03320 )
Retinol metabolism (hsa00830 )
Vascular smooth muscle contraction (hsa04270 )
Reactome Pathway
Fatty acids (R-HSA-211935 )
Miscellaneous substrates (R-HSA-211958 )
PPARA activates gene expression (R-HSA-1989781 )
Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE) (R-HSA-2142816 )
Synthesis of Leukotrienes (LT) and Eoxins (EX) (R-HSA-2142691 )
Eicosanoids (R-HSA-211979 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Clofibrate DMPC1J7 Dysbetalipoproteinemia 5C80.2 Approved [1]
Estrone DM5T6US Acne vulgaris ED80 Approved [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.52E-03 -5.23E-02 -2.40E-01
Alopecia ED70 Skin from scalp 7.78E-01 -1.25E-02 -8.27E-02
Alzheimer's disease 8A20 Entorhinal cortex 6.09E-03 -5.38E-02 -3.60E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.34E-01 -1.45E-02 -1.27E-01
Aortic stenosis BB70 Calcified aortic valve 8.30E-01 -2.76E-01 -2.93E-01
Apnea 7A40 Hyperplastic tonsil 4.83E-01 3.10E-03 9.73E-03
Arthropathy FA00-FA5Z Peripheral blood 5.55E-01 8.73E-02 8.17E-01
Asthma CA23 Nasal and bronchial airway 1.69E-07 -2.20E-01 -2.75E-01
Atopic dermatitis EA80 Skin 4.06E-01 1.40E-04 1.35E-03
Autism 6A02 Whole blood 3.68E-02 -1.47E-01 -8.71E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.17E-01 -6.52E-02 -3.08E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.55E-01 5.97E-02 3.57E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.47E-01 1.03E-02 3.39E-02
Batten disease 5C56.1 Whole blood 7.55E-02 3.11E-02 3.82E-01
Behcet's disease 4A62 Peripheral blood 3.78E-01 -2.02E-02 -1.82E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.58E-01 -3.15E-02 -2.13E-01
Bladder cancer 2C94 Bladder tissue 2.73E-05 7.82E-01 3.89E+00
Breast cancer 2C60-2C6Z Breast tissue 1.62E-08 -6.45E-02 -1.67E-01
Cardioembolic stroke 8B11.20 Whole blood 8.96E-04 1.43E-01 9.63E-01
Cervical cancer 2C77 Cervical tissue 3.42E-01 -5.59E-02 -2.57E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.08E-01 1.45E-01 5.58E-01
Chronic hepatitis C 1E51.1 Whole blood 1.54E-01 1.80E-01 1.04E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 5.57E-02 1.66E-01 6.75E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.38E-02 -5.11E-02 -2.64E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.20E-01 5.39E-02 5.66E-01
Colon cancer 2B90 Colon tissue 4.77E-01 -4.72E-02 -2.07E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.81E-01 -2.01E-01 -7.03E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.69E-01 -1.87E-02 -1.04E-01
Endometriosis GA10 Endometrium tissue 2.26E-01 5.21E-02 2.11E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.49E-01 4.50E-02 3.01E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.88E-09 -5.08E-01 -1.74E+00
Gastric cancer 2B72 Gastric tissue 9.34E-02 -2.61E-01 -1.46E+00
Glioblastopma 2A00.00 Nervous tissue 4.74E-02 -6.01E-02 -2.12E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.64E-01 -1.57E-02 -5.41E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.37E-03 -3.03E-01 -1.34E+00
Head and neck cancer 2D42 Head and neck tissue 4.71E-03 -6.85E-02 -3.27E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.94E-02 -4.15E-02 -1.67E-01
Huntington's disease 8A01.10 Whole blood 2.96E-01 8.83E-02 7.00E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.54E-01 -4.53E-02 -2.12E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.46E-01 4.10E-02 6.00E-01
Influenza 1E30 Whole blood 9.93E-02 1.84E-01 2.02E+00
Interstitial cystitis GC00.3 Bladder tissue 1.80E-01 7.14E-02 9.82E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.32E-01 9.86E-02 6.74E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.37E-01 6.29E-02 2.69E-01
Ischemic stroke 8B11 Peripheral blood 8.40E-01 -8.45E-03 -4.84E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 2.18E-01 1.11E-02 6.75E-02
Lateral sclerosis 8B60.4 Skin 2.22E-01 1.14E-01 1.03E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 3.54E-01 6.29E-02 2.94E-01
Liver cancer 2C12.0 Liver tissue 7.17E-12 -2.23E+00 -1.69E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.48E-02 -1.65E+00 -4.21E+00
Lung cancer 2C25 Lung tissue 2.68E-04 -5.09E-02 -2.47E-01
Lupus erythematosus 4A40 Whole blood 5.14E-02 -2.41E-01 -2.92E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.96E-01 1.33E-02 8.78E-02
Major depressive disorder 6A70-6A7Z Whole blood 8.78E-01 4.01E-02 2.04E-01
Melanoma 2C30 Skin 5.11E-01 -2.05E-01 -2.20E-01
Multiple myeloma 2A83.1 Peripheral blood 1.15E-01 1.20E-01 1.13E+00
Multiple myeloma 2A83.1 Bone marrow 4.66E-04 -5.50E-01 -2.23E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.58E-02 -1.17E-01 -8.85E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.10E-01 -1.58E-02 -6.82E-02
Myelofibrosis 2A20.2 Whole blood 1.23E-01 4.78E-02 3.81E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.08E-02 4.19E-01 7.27E-01
Myopathy 8C70.6 Muscle tissue 4.15E-01 -2.50E-02 -1.48E-01
Neonatal sepsis KA60 Whole blood 5.16E-05 -1.68E-01 -6.30E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.52E-04 -8.18E-01 -2.09E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.60E-01 4.34E-02 7.01E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.73E-01 -6.35E-03 -5.57E-02
Olive pollen allergy CA08.00 Peripheral blood 3.56E-01 8.95E-02 5.77E-01
Oral cancer 2B6E Oral tissue 2.98E-03 -2.67E-01 -1.02E+00
Osteoarthritis FA00-FA0Z Synovial tissue 3.18E-01 2.71E-02 1.80E-01
Osteoporosis FB83.1 Bone marrow 1.40E-02 3.02E-01 2.83E+00
Ovarian cancer 2C73 Ovarian tissue 8.85E-02 -1.56E-01 -6.42E-01
Pancreatic cancer 2C10 Pancreas 1.87E-01 -3.32E-01 -9.89E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.36E-01 -3.61E-02 -2.30E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.47E-01 -4.24E-02 -5.10E-01
Pituitary cancer 2D12 Pituitary tissue 5.26E-01 8.00E-02 2.34E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.96E-01 8.74E-02 4.53E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.36E-01 3.11E-03 4.65E-02
Polycythemia vera 2A20.4 Whole blood 5.47E-08 1.64E-01 1.18E+00
Pompe disease 5C51.3 Biceps muscle 4.63E-01 -5.57E-02 -4.68E-01
Preterm birth KA21.4Z Myometrium 7.04E-01 -2.50E-02 -2.02E-01
Prostate cancer 2C82 Prostate 9.24E-04 -7.13E-01 -9.00E-01
Psoriasis EA90 Skin 7.41E-12 -1.94E-01 -5.98E-01
Rectal cancer 2B92 Rectal colon tissue 9.55E-03 -2.22E-01 -1.99E+00
Renal cancer 2C90-2C91 Kidney 2.66E-03 -3.50E+00 -2.06E+00
Retinoblastoma 2D02.2 Uvea 5.49E-02 -1.47E-01 -1.00E+00
Rheumatoid arthritis FA20 Synovial tissue 1.17E-01 -9.04E-02 -6.15E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.55E-01 9.07E-03 8.18E-02
Schizophrenia 6A20 Prefrontal cortex 3.82E-01 3.25E-02 1.10E-01
Schizophrenia 6A20 Superior temporal cortex 8.95E-01 3.22E-02 2.90E-01
Scleroderma 4A42.Z Whole blood 4.51E-01 -3.58E-02 -3.56E-01
Seizure 8A60-8A6Z Whole blood 7.75E-01 9.07E-02 6.14E-01
Sensitive skin EK0Z Skin 9.08E-01 -4.39E-03 -3.25E-02
Sepsis with septic shock 1G41 Whole blood 9.43E-03 -4.94E-02 -2.13E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.94E-02 6.39E-01 1.63E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.74E-01 -4.82E-02 -2.68E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.15E-02 -1.32E-01 -1.60E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.82E-01 -1.32E-01 -1.06E+00
Skin cancer 2C30-2C3Z Skin 6.16E-03 -1.90E-01 -4.00E-01
Thrombocythemia 3B63 Whole blood 1.09E-02 1.09E-01 7.46E-01
Thrombocytopenia 3B64 Whole blood 3.48E-01 9.00E-02 5.41E-01
Thyroid cancer 2D10 Thyroid 9.49E-06 1.20E-01 5.30E-01
Tibial muscular dystrophy 8C75 Muscle tissue 7.15E-01 -1.48E-01 -6.42E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.25E-01 3.11E-02 6.57E-01
Type 2 diabetes 5A11 Liver tissue 4.37E-02 -3.83E-01 -1.11E+00
Ureter cancer 2C92 Urothelium 2.00E-03 -2.21E-01 -1.46E+00
Uterine cancer 2C78 Endometrium tissue 2.96E-02 -6.24E-02 -2.21E-01
Vitiligo ED63.0 Skin 3.53E-03 -8.01E-02 -1.41E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Regulation of CYP2E1 by ethanol and palmitic acid and CYP4A11 by clofibrate in primary cultures of human hepatocytes. Toxicol Sci. 2004 Jun;79(2):233-41.
2 Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms. Endocrinology. 2003 Aug;144(8):3382-98.