Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE4G629)

DME Name Succinic semialdehyde reductase (AKR7A2)
Synonyms AFB1 aldehyde reductase 1; Aflatoxin B1 aldehyde reductase member 2; Aldoketoreductase 7; SSA reductase; AFAR; AFAR1; AFB1-AR 1; AKR7; AKR7A2
Gene Name AKR7A2
UniProt ID
ARK72_HUMAN
INTEDE ID
DME0234
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
8574
EC Number EC: 1.1.1.B47
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.B47
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MLSAASRVVSRAAVHCALRSPPPEARALAMSRPPPPRVASVLGTMEMGRRMDAPASAAAV
RAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVR
SQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAE
ICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYE
DKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMY
HHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR
Function
This enzyme catalyzes the NADPH-dependent reduction of succinic semialdehyde to gamma-hydroxybutyrate. It may have an important role in producing the neuromodulator gamma-hydroxybutyrate (GHB) and has broad substrate specificity. It also has NADPH-dependent aldehyde reductase activity towards 2-carboxybenzaldehyde, 2-nitrobenzaldehyde and pyridine-2- aldehyde (in vitro). It can reduce 1,2-naphthoquinone and 9,10- phenanthrenequinone (in vitro) and reduce the dialdehyde protein- binding form of aflatoxin B1 (AFB1) to the non-binding AFB1 dialcohol. It may be involved in protection of liver against the toxic and carcinogenic effects of AFB1, a potent hepatocarcinogen.
KEGG Pathway
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Reactome Pathway
Aflatoxin activation and detoxification (R-HSA-5423646 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Doxorubicin DMVP5YE Acute myelogenous leukaemia 2A41 Approved [1]
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Vilaprisan DME7VZD Endometriosis GA10 Phase 2 [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.54E-17 4.90E-01 1.10E+00
Alopecia ED70 Skin from scalp 1.14E-01 -2.01E-03 -9.38E-03
Alzheimer's disease 8A20 Entorhinal cortex 3.13E-01 7.17E-02 2.34E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.44E-01 2.47E-01 7.43E-01
Aortic stenosis BB70 Calcified aortic valve 6.95E-01 -7.30E-02 -6.52E-02
Apnea 7A40 Hyperplastic tonsil 4.50E-01 -2.58E-01 -5.35E-01
Arthropathy FA00-FA5Z Peripheral blood 7.31E-02 -2.11E-01 -1.05E+00
Asthma CA23 Nasal and bronchial airway 4.93E-03 1.57E-01 2.84E-01
Atopic dermatitis EA80 Skin 2.73E-01 1.12E-01 3.03E-01
Autism 6A02 Whole blood 2.92E-02 -1.09E-01 -3.52E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.41E-01 1.96E-01 8.07E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.78E-01 -4.16E-01 -1.05E+00
Bacterial infection of gingival 1C1H Gingival tissue 3.70E-04 -1.74E-01 -5.33E-01
Batten disease 5C56.1 Whole blood 8.66E-01 8.35E-02 5.93E-01
Behcet's disease 4A62 Peripheral blood 4.54E-01 -5.89E-02 -4.12E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.68E-01 -9.34E-03 -3.72E-02
Bladder cancer 2C94 Bladder tissue 2.47E-08 -6.33E-01 -4.45E+00
Breast cancer 2C60-2C6Z Breast tissue 2.47E-03 -8.74E-02 -2.28E-01
Cardioembolic stroke 8B11.20 Whole blood 9.52E-09 -3.60E-01 -1.82E+00
Cervical cancer 2C77 Cervical tissue 2.42E-01 -3.08E-01 -5.34E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.83E-01 -1.14E-01 -1.21E-01
Chronic hepatitis C 1E51.1 Whole blood 1.97E-01 -2.17E-01 -7.06E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.10E-01 -1.77E-01 -4.07E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.79E-01 1.18E-01 3.87E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.82E-02 -6.10E-01 -1.32E+00
Colon cancer 2B90 Colon tissue 4.18E-42 -4.54E-01 -1.44E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.02E-01 7.79E-01 1.36E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.01E-01 1.46E-01 3.37E-01
Endometriosis GA10 Endometrium tissue 6.71E-01 -2.18E-02 -4.92E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.79E-01 3.22E-02 3.36E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.47E-07 6.83E-01 1.68E+00
Gastric cancer 2B72 Gastric tissue 1.26E-01 2.35E-01 1.10E+00
Glioblastopma 2A00.00 Nervous tissue 1.05E-88 6.93E-01 1.68E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.04E-01 3.93E-01 5.70E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.26E-02 4.30E-01 9.28E-01
Head and neck cancer 2D42 Head and neck tissue 1.96E-10 -3.14E-01 -1.02E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.62E-01 8.12E-03 2.22E-02
Huntington's disease 8A01.10 Whole blood 7.32E-01 -1.33E-01 -3.08E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.92E-02 6.81E-01 1.58E+00
Immunodeficiency 4A00-4A20 Peripheral blood 7.56E-01 -4.96E-02 -7.36E-01
Influenza 1E30 Whole blood 8.27E-02 -3.40E-01 -1.39E+00
Interstitial cystitis GC00.3 Bladder tissue 2.41E-02 -1.38E-01 -1.42E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.73E-03 2.18E-01 1.16E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.58E-02 -1.17E-01 -3.28E-01
Ischemic stroke 8B11 Peripheral blood 7.34E-02 -6.10E-02 -3.66E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.81E-06 -3.03E-01 -6.37E-01
Lateral sclerosis 8B60.4 Skin 2.05E-01 1.34E-01 1.12E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 9.28E-01 -5.03E-03 -1.07E-02
Liver cancer 2C12.0 Liver tissue 2.79E-07 -2.24E-01 -6.60E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.61E-01 -3.91E-01 -9.24E-01
Lung cancer 2C25 Lung tissue 4.07E-23 2.29E-01 7.17E-01
Lupus erythematosus 4A40 Whole blood 3.84E-01 6.77E-02 1.41E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.93E-01 -1.31E-02 -5.56E-02
Major depressive disorder 6A70-6A7Z Whole blood 4.70E-01 -6.83E-02 -2.39E-01
Melanoma 2C30 Skin 2.88E-01 1.88E-01 2.54E-01
Multiple myeloma 2A83.1 Peripheral blood 8.35E-01 -1.48E-01 -3.96E-01
Multiple myeloma 2A83.1 Bone marrow 5.70E-06 9.97E-01 3.96E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.55E-01 -3.31E-01 -7.02E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.56E-01 1.16E-01 2.96E-01
Myelofibrosis 2A20.2 Whole blood 2.26E-02 -1.60E-01 -8.03E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.40E-03 -3.45E-01 -5.41E-01
Myopathy 8C70.6 Muscle tissue 6.71E-01 1.39E-02 5.41E-02
Neonatal sepsis KA60 Whole blood 8.61E-11 -2.48E-01 -7.62E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.43E-03 5.44E-01 1.73E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.80E-01 -2.52E-01 -5.46E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.28E-01 2.91E-01 6.53E-01
Olive pollen allergy CA08.00 Peripheral blood 3.34E-01 3.63E-01 6.42E-01
Oral cancer 2B6E Oral tissue 9.23E-01 2.08E-01 4.80E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.52E-01 6.83E-01 6.56E-01
Osteoporosis FB83.1 Bone marrow 4.03E-01 1.81E-01 9.81E-01
Ovarian cancer 2C73 Ovarian tissue 7.50E-03 -4.02E-01 -1.41E+00
Pancreatic cancer 2C10 Pancreas 4.51E-01 8.85E-02 1.97E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.23E-01 -7.12E-02 -1.90E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.57E-01 -5.77E-03 -4.83E-02
Pituitary cancer 2D12 Pituitary tissue 1.24E-02 2.11E-01 6.23E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.04E-03 4.95E-01 1.33E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.50E-01 1.01E-01 9.65E-01
Polycythemia vera 2A20.4 Whole blood 1.06E-05 -2.28E-01 -1.08E+00
Pompe disease 5C51.3 Biceps muscle 1.83E-02 -1.97E-01 -1.86E+00
Preterm birth KA21.4Z Myometrium 2.72E-01 -8.37E-02 -2.82E-01
Prostate cancer 2C82 Prostate 1.94E-02 -3.06E-01 -7.20E-01
Psoriasis EA90 Skin 3.16E-06 -1.69E-01 -4.77E-01
Rectal cancer 2B92 Rectal colon tissue 1.37E-05 -9.42E-01 -4.34E+00
Renal cancer 2C90-2C91 Kidney 1.99E-02 -1.57E-01 -4.97E-01
Retinoblastoma 2D02.2 Uvea 2.46E-05 7.21E-01 4.99E+00
Rheumatoid arthritis FA20 Synovial tissue 8.26E-06 6.07E-01 2.90E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.94E-01 9.48E-02 4.47E-01
Schizophrenia 6A20 Prefrontal cortex 5.58E-01 1.14E-02 2.51E-02
Schizophrenia 6A20 Superior temporal cortex 1.74E-01 -6.55E-02 -3.03E-01
Scleroderma 4A42.Z Whole blood 3.21E-03 -1.32E-01 -1.16E+00
Seizure 8A60-8A6Z Whole blood 6.26E-01 -1.63E-01 -4.07E-01
Sensitive skin EK0Z Skin 2.72E-01 -1.08E-01 -6.38E-01
Sepsis with septic shock 1G41 Whole blood 2.67E-28 -3.41E-01 -1.29E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.10E-03 -4.42E-01 -1.67E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.84E-05 1.90E+00 4.59E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 4.04E-01 5.49E-01 1.24E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.70E-01 -2.82E-01 -7.48E-01
Skin cancer 2C30-2C3Z Skin 1.07E-01 -7.60E-02 -1.86E-01
Thrombocythemia 3B63 Whole blood 2.57E-03 -9.88E-02 -4.93E-01
Thrombocytopenia 3B64 Whole blood 6.19E-01 4.46E-01 4.00E-01
Thyroid cancer 2D10 Thyroid 2.60E-32 -4.54E-01 -1.85E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.94E-01 -2.21E-01 -6.57E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.12E-01 1.83E-01 7.66E-01
Type 2 diabetes 5A11 Liver tissue 3.46E-01 -1.98E-01 -7.39E-01
Ureter cancer 2C92 Urothelium 5.23E-01 -1.24E-01 -5.93E-01
Uterine cancer 2C78 Endometrium tissue 2.53E-22 -6.86E-01 -9.08E-01
Vitiligo ED63.0 Skin 8.79E-01 4.30E-03 1.67E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Naturally occurring variants of human aldo-keto reductases with reduced in vitro metabolism of daunorubicin and doxorubicin. J Pharmacol Exp Ther. 2010 Dec;335(3):533-45.
2 Characterization of the pharmacokinetics of vilaprisan: bioavailability, excretion, biotransformation, and drug-drug interaction potential. Clin Pharmacokinet. 2018 Aug;57(8):1001-1015.