Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEFK2EH)

DME Name	HMG-CoA reductase (HMGCR)
Synonyms	Hydroxy-methylglutaryl coenzyme A reductase; 3-hydroxy-3-methylglutaryl-coenzyme A reductase; HMGCR
Gene Name	HMGCR
UniProt ID	HMDH_HUMAN
INTEDE ID	DME0224
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Gene ID	3156
EC Number	EC: 1.1.1.34 Oxidoreductase CH-OH donor oxidoreductase NAD/NADP oxidoreductase EC: 1.1.1.34
Lineage	Species: Homo sapiens Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Sequence	MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYECPKFEEDVLSS DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG LNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIG VGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFAR VLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQNSTADTSKVSLGLDENVSKR IEPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQTETESTLSLKNPITSPVVT QKKVPDNCCRREPMLVRNNQKCDSVEEETGINRERKVEVIKPLVAETDTPNRATFVVGNS SLLDTSSVLVTQEPEIELPREPRPNEECLQILGNAEKGAKFLSDAEIIQLVNAKHIPAYK LETLMETHERGVSIRRQLLSKKLSEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGV AGPLCLDEKEFQVPMATTEGCLVASTNRGCRAIGLGGGASSRVLADGMTRGPVVRLPRAC DSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMI SKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREV LKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITL MEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLAR IVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA
Function	This enzyme is the rate-limiting enzyme in cholesterol biosynthesis as well as in the biosynthesis of nonsterol isoprenoids that are essential for normal cell function including ubiquinone and geranylgeranyl proteins.
KEGG Pathway	AMPK signaling pathway (hsa04152 ) Bile secretion (hsa04976 ) Metabolic pathways (hsa01100 ) Terpenoid backbone biosynthesis (hsa00900 )
Reactome Pathway	Cholesterol biosynthesis (R-HSA-191273 ) PPARA activates gene expression [P04035-1] (R-HSA-1989781 ) Activation of gene expression by SREBF (SREBP) [P04035-1] (R-HSA-2426168 )

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	6.39E-01	-1.94E-02	-4.35E-02
Alopecia	ED70	Skin from scalp	1.06E-01	1.17E-01	4.50E-01
Alzheimer's disease	8A20	Entorhinal cortex	4.51E-09	-4.08E-01	-7.58E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	7.69E-01	-4.76E-02	-2.70E-01
Aortic stenosis	BB70	Calcified aortic valve	8.95E-01	-1.67E-01	-1.63E-01
Apnea	7A40	Hyperplastic tonsil	3.88E-01	-9.75E-01	-9.58E-01
Arthropathy	FA00-FA5Z	Peripheral blood	1.23E-01	1.81E-01	7.50E-01
Asthma	CA23	Nasal and bronchial airway	6.19E-01	-2.83E-02	-7.61E-02
Atopic dermatitis	EA80	Skin	3.45E-04	-4.77E-01	-1.17E+00
Autism	6A02	Whole blood	2.30E-04	4.57E-01	9.77E-01
Autoimmune uveitis	9A96	Peripheral monocyte	1.70E-01	8.97E-01	1.78E+00
Autosomal dominant monocytopenia	4B04	Whole blood	4.48E-01	4.40E-01	6.40E-01
Bacterial infection of gingival	1C1H	Gingival tissue	3.02E-27	-9.07E-01	-2.21E+00
Batten disease	5C56.1	Whole blood	5.44E-01	-2.20E-01	-1.28E+00
Behcet's disease	4A62	Peripheral blood	9.84E-01	1.98E-01	4.91E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	2.83E-01	-6.98E-02	-3.01E-01
Bladder cancer	2C94	Bladder tissue	6.08E-03	-6.23E-01	-2.08E+00
Breast cancer	2C60-2C6Z	Breast tissue	5.11E-15	6.45E-01	6.03E-01
Cardioembolic stroke	8B11.20	Whole blood	4.60E-05	3.47E-01	1.63E+00
Cervical cancer	2C77	Cervical tissue	1.46E-04	-4.16E-01	-9.24E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	9.01E-01	1.68E-01	2.35E-01
Chronic hepatitis C	1E51.1	Whole blood	1.28E-01	1.64E-01	4.92E-01
Chronic obstructive pulmonary disease	CA22	Lung tissue	4.81E-01	1.11E-01	2.61E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	1.11E-02	-1.23E-01	-2.86E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	1.03E-02	-1.05E+00	-1.29E+00
Colon cancer	2B90	Colon tissue	2.34E-18	-3.81E-01	-8.15E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	1.47E-02	8.09E-01	1.92E+00
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	8.50E-01	2.13E-01	4.96E-01
Endometriosis	GA10	Endometrium tissue	7.50E-01	2.14E-01	3.77E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	1.85E-01	2.30E-01	9.37E-01
Familial hypercholesterolemia	5C80.00	Whole blood	1.01E-05	6.50E-01	1.53E+00
Gastric cancer	2B72	Gastric tissue	2.50E-01	5.96E-01	6.39E-01
Glioblastopma	2A00.00	Nervous tissue	9.16E-06	-1.87E-01	-2.35E-01
Glioma	2A00.0Y-2A00.0Z	Brain stem tissue	7.68E-01	2.36E-01	5.23E-01
Glioma	2A00.0Y-2A00.0Z	White matter tissue	2.61E-01	5.70E-01	7.52E-01
Head and neck cancer	2D42	Head and neck tissue	2.11E-03	-1.87E-01	-2.96E-01
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	8.48E-01	3.04E-01	3.79E-01
Huntington's disease	8A01.10	Whole blood	7.81E-01	-5.52E-02	-1.39E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	6.37E-03	-1.50E+00	-2.88E+00
Immunodeficiency	4A00-4A20	Peripheral blood	9.79E-01	-1.28E-01	-5.39E-01
Influenza	1E30	Whole blood	1.69E-03	-2.32E+00	-5.06E+00
Interstitial cystitis	GC00.3	Bladder tissue	1.37E-05	-9.92E-01	-5.60E+00
Intracranial aneurysm	8B01.0	Intracranial artery	4.31E-01	2.41E-01	5.50E-01
Irritable bowel syndrome	DD91.0	Rectal colon tissue	8.63E-01	7.35E-02	1.99E-01
Ischemic stroke	8B11	Peripheral blood	1.53E-01	-2.93E-01	-6.67E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	2.00E-03	7.71E-02	2.42E-01
Lateral sclerosis	8B60.4	Skin	9.05E-01	2.32E-02	9.89E-02
Lateral sclerosis	8B60.4	Cervical spinal cord	4.07E-01	-2.95E-01	-2.79E-01
Liver cancer	2C12.0	Liver tissue	5.14E-03	5.19E-01	5.98E-01
Liver failure	DB99.7-DB99.8	Liver tissue	6.68E-04	-1.71E+00	-1.72E+00
Lung cancer	2C25	Lung tissue	2.94E-17	-2.75E-01	-6.58E-01
Lupus erythematosus	4A40	Whole blood	1.03E-05	3.49E-01	4.64E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	6.03E-01	-2.16E-02	-1.25E-01
Major depressive disorder	6A70-6A7Z	Whole blood	5.17E-02	1.37E-01	4.79E-01
Melanoma	2C30	Skin	9.79E-07	-1.10E+00	-1.37E+00
Multiple myeloma	2A83.1	Peripheral blood	4.07E-01	-1.31E-01	-1.96E-01
Multiple myeloma	2A83.1	Bone marrow	1.48E-06	1.01E+00	4.34E+00
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	4.58E-02	-4.74E-01	-1.62E+00
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	1.47E-01	2.38E-02	4.90E-02
Myelofibrosis	2A20.2	Whole blood	5.87E-03	-3.08E-01	-1.09E+00
Myocardial infarction	BA41-BA50	Peripheral blood	3.20E-02	2.17E-01	4.86E-01
Myopathy	8C70.6	Muscle tissue	9.06E-02	3.60E-01	1.03E+00
Neonatal sepsis	KA60	Whole blood	7.16E-09	4.24E-01	8.77E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	2.05E-05	1.74E+00	2.83E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	1.61E-01	5.65E-01	6.55E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	4.02E-02	-5.99E-01	-2.54E+00
Olive pollen allergy	CA08.00	Peripheral blood	3.98E-01	-3.14E-01	-6.01E-01
Oral cancer	2B6E	Oral tissue	5.43E-01	-2.00E-01	-1.42E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	4.21E-02	3.93E-01	6.88E-01
Osteoporosis	FB83.1	Bone marrow	7.05E-02	-2.67E-01	-1.26E+00
Ovarian cancer	2C73	Ovarian tissue	1.67E-01	7.00E-01	7.45E-01
Pancreatic cancer	2C10	Pancreas	9.76E-02	4.18E-01	5.97E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	5.60E-01	-5.47E-01	-7.30E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	3.68E-04	5.64E-01	1.74E+00
Pituitary cancer	2D12	Pituitary tissue	1.18E-03	7.67E-01	1.19E+00
Pituitary gonadotrope tumour	2D12	Pituitary tissue	3.49E-03	8.38E-01	1.43E+00
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	5.86E-01	-2.60E-02	-1.41E-01
Polycythemia vera	2A20.4	Whole blood	2.53E-01	-1.03E-01	-3.76E-01
Pompe disease	5C51.3	Biceps muscle	4.74E-01	1.80E-01	7.75E-01
Preterm birth	KA21.4Z	Myometrium	5.43E-01	1.49E-02	3.11E-02
Prostate cancer	2C82	Prostate	1.80E-02	7.07E-01	9.16E-01
Psoriasis	EA90	Skin	3.84E-06	3.32E-01	7.09E-01
Rectal cancer	2B92	Rectal colon tissue	9.62E-02	-1.68E-01	-4.72E-01
Renal cancer	2C90-2C91	Kidney	1.63E-01	2.41E-01	2.63E-01
Retinoblastoma	2D02.2	Uvea	7.21E-02	-5.96E-01	-8.01E-01
Rheumatoid arthritis	FA20	Synovial tissue	2.43E-01	-4.35E-01	-7.32E-01
Rhinovirus infection	CA42.1	Nasal epithelium tissue	2.62E-01	1.45E-02	5.55E-02
Schizophrenia	6A20	Prefrontal cortex	2.37E-02	-3.62E-01	-5.36E-01
Schizophrenia	6A20	Superior temporal cortex	6.68E-01	-7.58E-03	-1.64E-02
Scleroderma	4A42.Z	Whole blood	1.46E-01	9.09E-02	5.67E-01
Seizure	8A60-8A6Z	Whole blood	3.13E-01	-5.17E-02	-1.70E-01
Sensitive skin	EK0Z	Skin	7.19E-01	-8.20E-03	-2.76E-02
Sepsis with septic shock	1G41	Whole blood	3.79E-11	3.52E-01	8.19E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	8.40E-01	1.13E-01	1.66E-01
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	1.96E-02	-5.98E-01	-8.38E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	2.45E-01	-2.13E-01	-1.51E+00
Sjogren's syndrome	4A43.2	Salivary gland tissue	7.19E-02	6.27E-01	2.04E+00
Skin cancer	2C30-2C3Z	Skin	1.36E-59	-9.99E-01	-1.83E+00
Thrombocythemia	3B63	Whole blood	2.03E-02	-3.41E-01	-1.18E+00
Thrombocytopenia	3B64	Whole blood	5.75E-01	-7.84E-01	-5.45E-01
Thyroid cancer	2D10	Thyroid	7.65E-32	-9.27E-01	-1.55E+00
Tibial muscular dystrophy	8C75	Muscle tissue	6.64E-03	4.05E-01	1.27E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	1.97E-02	-6.26E-01	-3.38E+00
Type 2 diabetes	5A11	Liver tissue	4.42E-03	7.71E-01	1.44E+00
Ureter cancer	2C92	Urothelium	1.77E-01	4.81E-03	1.27E-02
Uterine cancer	2C78	Endometrium tissue	5.69E-01	-1.47E-01	-1.39E-01
Vitiligo	ED63.0	Skin	5.04E-01	1.14E-01	3.59E-01
------------------------------------------------------------------------------------


⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name

HMG-CoA reductase (HMGCR) DTT Info

DME DTT Type

Successful

12 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aspirin	DM672AH	Acute coronary syndrome	BA41	Approved	[1]
Atorvastatin	DMF28YC	Acute coronary syndrome	BA41	Approved	[2]
Cerivastatin	DMXCM7H	Hyperlipidaemia	5C80	Approved	[3]
Fluvastatin	DM4MDJY	Arteriosclerosis	BD40	Approved	[2]
Lovastatin	DM9OZWQ	Arteriosclerosis	BD40	Approved	[4]
PITAVASTATIN CALCIUM	DM1UJO0	Dyslipidemia	5C80-5C81	Approved	[5]
Pravastatin	DM6A0X7	Adult acute monocytic leukemia		Approved	[6]
Rosuvastatin	DMMIQ7G	Arteriosclerosis	BD40	Approved	[7]
Simvastatin	DM30SGU	Arteriosclerosis	BD40	Approved	[2]
Teriflunomide	DMQ2FKJ	Hyperlipidaemia	5C80	Approved	[1]
TOCOTRIENOL	DM1UE67	Hyperlipidaemia	5C80	Approved	[8]
LAROPIPRANT	DM5FABJ	Coronary heart disease	BA80.Z	Phase 4	[9]
------------------------------------------------------------------------------------


⏷ Show the Full List of 12 Approved Drug(s)

3 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CRILVASTATIN	DMO1ZGX	Hyperlipidaemia	5C80	Phase 2	[10]
XZK-monascus	DMPI6N0	Hyperlipidaemia	5C80	Phase 2	[11]
NCX-6560	DMM7RC5	Cardiovascular disease	BA00-BE2Z	Phase 1	[12]
------------------------------------------------------------------------------------

24 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
2-cyclopropyl-4-substituted-phenoxy-quinoline derivative 1	DMTJ1G8	N. A.	N. A.	Patented	[13]
Atorvastatin lactole derivative 1	DMRG1NL	N. A.	N. A.	Patented	[13]
Hexahydro naphthalene derivative 1	DMT2Z0I	N. A.	N. A.	Patented	[13]
Hexahydro naphthalene derivative 2	DMFG9HP	N. A.	N. A.	Patented	[13]
Hexahydro naphthalene derivative 3	DM1KT4I	N. A.	N. A.	Patented	[13]
Lactol derivative 1	DMWC3P5	N. A.	N. A.	Patented	[13]
Lactol derivative 2	DMP3GRA	N. A.	N. A.	Patented	[13]
Pitavastatin derivative 1	DMFZ9Q3	N. A.	N. A.	Patented	[13]
PMID27537201-Compound-Figure11	DM9C4XH	N. A.	N. A.	Patented	[13]
PMID27537201-Compound-Figure13b	DMPDTHQ	N. A.	N. A.	Patented	[13]
PMID27537201-Compound-Figure13c	DMWZ1PD	N. A.	N. A.	Patented	[13]
PMID27537201-Compound-Figure15a	DMVBJKH	N. A.	N. A.	Patented	[13]
PMID27537201-Compound-Figure15b	DMZ6N2J	N. A.	N. A.	Patented	[13]
PMID27537201-Compound-Figure17	DMWKVZD	N. A.	N. A.	Patented	[13]
Poly-substituted azoles statin lactone derivative 1	DMDLS54	N. A.	N. A.	Patented	[13]
Poly-substituted azoles statin lactone derivative 2	DM5G3CN	N. A.	N. A.	Patented	[13]
Poly-substituted miazine derivative 1	DMQJ38W	N. A.	N. A.	Patented	[13]
Pravastatin derivative 1	DM7XYRA	N. A.	N. A.	Patented	[13]
Quinoline derivative 1	DMRY2HL	N. A.	N. A.	Patented	[13]
Quinoline derivative 16	DMTHG87	N. A.	N. A.	Patented	[13]
Quinoline derivative 17	DMKULV8	N. A.	N. A.	Patented	[13]
Sterol derivative 1	DM5U36G	N. A.	N. A.	Patented	[13]
Sterol derivative 2	DME1B23	N. A.	N. A.	Patented	[13]
Sterol derivative 3	DMOT1FQ	N. A.	N. A.	Patented	[13]
------------------------------------------------------------------------------------


⏷ Show the Full List of 24 Patented Agent(s)

12 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Dalvastatin	DMZ38EN	Hyperlipidaemia	5C80	Discontinued in Phase 3	[14]
Bervastatin	DMEK6J0	Thrombosis	DB61-GB90	Discontinued in Phase 2	[15]
BMY-21950	DM2NBXR	Hyperlipidaemia	5C80	Discontinued in Phase 2	[16]
GLENVASTATIN	DMT1LQS	Hyperlipidaemia	5C80	Discontinued in Phase 2	[17]
RBx10558	DMYSADI	Hyperlipidaemia	5C80	Discontinued in Phase 2	[18]
PF-3052334	DMOQZIW	Arteriosclerosis	BD40	Discontinued in Phase 1	[19]
BMY-22089	DMZFTLK	Hyperlipidaemia	5C80	Terminated	[16]
CP-83101	DMSOT07	Arteriosclerosis	BD40	Terminated	[20]
GT-16-239	DMA6RL2	Arteriosclerosis	BD40	Terminated	[21]
Mevastatin	DM1LGKP	N. A.	N. A.	Terminated	[22]
SQ-33600	DMT5LX0	Hyperlipidaemia	5C80	Terminated	[23]
SR12813	DMU2ZVY	Arteriosclerosis	BD40	Terminated	[24]
------------------------------------------------------------------------------------


⏷ Show the Full List of 12 Discontinued Drug(s)

82 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(E)-5-octadecen-7,9-diynoic acid	DMIPY3W	Discovery agent	N.A.	Investigative	[25]
(E)-octadecan-9-ynoic acid	DMBLGF6	Discovery agent	N.A.	Investigative	[25]
(R)-Mevalonate	DMEXLUR	Discovery agent	N.A.	Investigative	[26]
(Z)-5-octadecen-7,9-diynoic acid	DM4X9GW	Discovery agent	N.A.	Investigative	[25]
(Z)-7-octedecan-9-ynoic acid	DMKWLSB	Discovery agent	N.A.	Investigative	[25]
1,4-Dithiothreitol	DMIFOXE	Discovery agent	N.A.	Investigative	[26]
2'-Monophosphoadenosine 5'-Diphosphoribose	DME9S8M	Discovery agent	N.A.	Investigative	[26]
3-(1,3 dodecadiynyl)-6-oxiranebutanoic acid	DMQC168	Discovery agent	N.A.	Investigative	[25]
3-Hydroxy-3-Methyl-Glutaric Acid	DMJD0UV	Discovery agent	N.A.	Investigative	[26]
5-ketodihydromevinolin	DMXVPL1	Discovery agent	N.A.	Investigative	[27]
6-hydroxy-7,9-octadecadiynoic acid	DMPQTNK	Discovery agent	N.A.	Investigative	[25]
7,9-octadecadiynoic acid	DMO8GEI	Discovery agent	N.A.	Investigative	[25]
7,9-tetradecadiynoic acid	DMPEXTB	Discovery agent	N.A.	Investigative	[25]
9-octadecynoic acid	DM1DYU4	Discovery agent	N.A.	Investigative	[25]
BPL-001	DMKX6LY	Cardiovascular disease	BA00-BE2Z	Investigative	[28]
Brutieridin	DMKZM1L	Hypercholesterolaemia	5C80.0	Investigative	[28]
Coenzyme A	DM1I8LU	Discovery agent	N.A.	Investigative	[26]
DFGYVAE	DMR8M19	Discovery agent	N.A.	Investigative	[29]
F(4-Fluoro)VAE	DMTW571	Discovery agent	N.A.	Investigative	[30]
FPYVAE peptide	DMDUR4C	Discovery agent	N.A.	Investigative	[29]
GFPDGG	DMLM02I	Discovery agent	N.A.	Investigative	[30]
GFPEGG	DMGZTQW	Discovery agent	N.A.	Investigative	[30]
GFPTGG	DM9D8VH	Discovery agent	N.A.	Investigative	[30]
GLPDGG peptide	DMGTPDA	Discovery agent	N.A.	Investigative	[29]
GLPTGG	DME2YL6	Discovery agent	N.A.	Investigative	[30]
MT-001	DM7KIVX	Hypercholesterolaemia	5C80.0	Investigative	[28]
NCX-1067	DMUHXRA	Discovery agent	N.A.	Investigative	[28]
Nicotinamide-Adenine-Dinucleotide	DM9LRKB	N. A.	N. A.	Investigative	[26]
o-hydroxyatorvastatin	DMN37KO	Discovery agent	N.A.	Investigative	[31]
PMID1527791C29	DM7JKLM	Discovery agent	N.A.	Investigative	[32]
PMID15686906C17	DM50E6R	Discovery agent	N.A.	Investigative	[33]
PMID15686906C29	DMBZSKJ	Discovery agent	N.A.	Investigative	[33]
PMID1656041C11dd	DMJ8A4I	Discovery agent	N.A.	Investigative	[34]
PMID1656041C11ff	DM20TFH	Discovery agent	N.A.	Investigative	[34]
PMID1656041C11jj	DMLIXJW	Discovery agent	N.A.	Investigative	[34]
PMID1656041C11nn	DMNOMCT	Discovery agent	N.A.	Investigative	[34]
PMID1656041C4ff	DMW90GD	Discovery agent	N.A.	Investigative	[34]
PMID1656041C4rr	DMQGPJE	Discovery agent	N.A.	Investigative	[34]
PMID1656041C74	DMZVK16	Discovery agent	N.A.	Investigative	[34]
PMID17560788C29f	DMLX87P	Discovery agent	N.A.	Investigative	[35]
PMID17574411C41	DM6W73A	Discovery agent	N.A.	Investigative	[36]
PMID17574411C42	DM1YLF6	Discovery agent	N.A.	Investigative	[36]
PMID17574412C33	DM7HYPZ	Discovery agent	N.A.	Investigative	[37]
PMID18072721C50	DMK5PO8	Discovery agent	N.A.	Investigative	[19]
PMID18155906C16f	DM2U4NW	Discovery agent	N.A.	Investigative	[38]
PMID18412317C13b	DM6NL2B	Discovery agent	N.A.	Investigative	[39]
PMID1875346C18	DMTH0PD	Discovery agent	N.A.	Investigative	[40]
PMID1895299C1	DMA5P9Q	Discovery agent	N.A.	Investigative	[41]
PMID1895299C4p	DMAZWHB	Discovery agent	N.A.	Investigative	[41]
PMID1895299C6v	DM384PH	Discovery agent	N.A.	Investigative	[41]
PMID19502059C25d	DMTRL0X	Discovery agent	N.A.	Investigative	[42]
PMID1992138C8b	DMI3PCZ	Discovery agent	N.A.	Investigative	[43]
PMID1992149C13	DM2X1NY	Discovery agent	N.A.	Investigative	[44]
PMID1992149C9	DM9RENG	Discovery agent	N.A.	Investigative	[45]
PMID2153213C13b	DMUMYTB	Discovery agent	N.A.	Investigative	[46]
PMID2153213C13g	DM5TL2S	Discovery agent	N.A.	Investigative	[46]
PMID2153213C1a	DMVYB6Q	Discovery agent	N.A.	Investigative	[46]
PMID2153213C1e	DMRUJFZ	Discovery agent	N.A.	Investigative	[46]
PMID2153213C1f	DMOLIE1	Discovery agent	N.A.	Investigative	[46]
PMID2153213C2c	DMJ4126	Discovery agent	N.A.	Investigative	[46]
PMID2153213C2d	DMGAY4M	Discovery agent	N.A.	Investigative	[46]
PMID2153213C2f	DM6QXYE	Discovery agent	N.A.	Investigative	[46]
PMID2231594C3j	DMVI6EX	Discovery agent	N.A.	Investigative	[47]
PMID2231594C3k	DMJYHIM	Discovery agent	N.A.	Investigative	[47]
PMID2231594C3q	DMJQ5B0	Discovery agent	N.A.	Investigative	[47]
PMID2231594C3u	DMJ504Y	Discovery agent	N.A.	Investigative	[47]
PMID2296027C25	DMOKZ3R	Discovery agent	N.A.	Investigative	[48]
PMID2296027C29	DMY267E	Discovery agent	N.A.	Investigative	[48]
PMID2296036C2g	DM6VG8K	Discovery agent	N.A.	Investigative	[49]
PMID2296036C2t	DMBXCNA	Discovery agent	N.A.	Investigative	[49]
PMID2296036C4d	DMC6HQL	Discovery agent	N.A.	Investigative	[49]
PMID2296036C4i	DMSJ94N	Discovery agent	N.A.	Investigative	[49]
PMID2909732C7	DM9J5Q7	Discovery agent	N.A.	Investigative	[50]
PMID7932551C9	DM769YQ	Discovery agent	N.A.	Investigative	[51]
PMID8246233C28	DMRGY2X	Discovery agent	N.A.	Investigative	[52]
PMID8246233C35	DMUJ9F7	Discovery agent	N.A.	Investigative	[52]
PMID8246233C5ab	DMETHN7	Discovery agent	N.A.	Investigative	[52]
PMID8246234C3h	DMJWEXQ	Discovery agent	N.A.	Investigative	[53]
PMID8246237C18t	DMLOR6F	Discovery agent	N.A.	Investigative	[54]
PMID8426367C18	DMTURQZ	Discovery agent	N.A.	Investigative	[55]
rawsonol	DM9XOE6	Discovery agent	N.A.	Investigative	[56]
Statin	DM4WQHU	Hypercholesterolaemia	5C80.0	Investigative	[28]
------------------------------------------------------------------------------------


⏷ Show the Full List of 82 Investigative Drug(s)

References

1	Emerging drugs in peripheral arterial disease. Expert Opin Emerg Drugs. 2006 Mar;11(1):75-90.
2	Equally potent inhibitors of cholesterol synthesis in human hepatocytes have distinguishable effects on different cytochrome P450 enzymes. Biopharm Drug Dispos. 2000 Dec;21(9):353-64.
3	Emerging therapies for multiple myeloma. Expert Opin Emerg Drugs. 2009 Mar;14(1):99-127.
4	Microarray and biochemical analysis of lovastatin-induced apoptosis of squamous cell carcinomas. Neoplasia. 2002 Jul-Aug;4(4):337-46.
5	Cholesterol-lowering effect of NK-104, a 3-hydroxy-3-methylglutaryl-coenzyme A reductase inhibitor, in guinea pig model of hyperlipidemia. Arzneimittelforschung. 2001;51(3):197-203.
6	A randomized, double-blind trial comparing the efficacy and safety of pitavastatin versus pravastatin in patients with primary hypercholesterolemia. Atherosclerosis. 2002 Jun;162(2):373-9.
7	New dimension of statin action on ApoB atherogenicity. Clin Cardiol. 2003 Jan;26(1 Suppl 1):I7-10.
8	Inhibitory effect of delta-tocotrienol, a HMG CoA reductase inhibitor, on monocyte-endothelial cell adhesion. J Nutr Sci Vitaminol (Tokyo). 2002 Oct;48(5):332-7.
9	A novel c-Met inhibitor, MK8033, synergizes with carboplatin plus paclitaxel to inhibit ovarian cancer cell growth. Oncol Rep. 2013 May;29(5):2011-8.
10	Differences in hypolipidaemic effects of two statins on Hep G2 cells or human hepatocytes in primary culture. Br J Pharmacol. 1996 Aug;118(7):1862-8.
11	NMR evaluation of total statin content and HMG-CoA reductase inhibition in red yeast rice (Monascus spp.) food supplements. Chin Med. 2012 Mar 22;7:8.
12	Lovastatin and beyond: the history of the HMG-CoA reductase inhibitors. Nat Rev Drug Discov. 2003 Jul;2(7):517-26.
13	HMG-CoA Reductase inhibitors: an updated review of patents of novel compounds and formulations (2011-2015).Expert Opin Ther Pat. 2016 Nov;26(11):1257-1272.
14	RG 12561 (dalvastatin): a novel synthetic inhibitor of HMG-CoA reductase and cholesterol-lowering agent. Pharmacology. 1993;46(1):13-22.
15	Effects of simvastatin, an HMG-CoA reductase inhibitor, in patients with hypertriglyceridemia. Clin Cardiol. 2003 Jan;26(1):18-24.
16	Selective inhibition of cholesterol synthesis in liver versus extrahepatic tissues by HMG-CoA reductase inhibitors. J Lipid Res. 1990 Jul;31(7):1271-82.
17	Bile acid derived HMG-CoA reductase inhibitors. Biochim Biophys Acta. 1994 Nov 29;1227(3):137-54.
18	New Frontiers in the Treatment of Diabetic Dyslipidemia. Rev Diabet Stud. 2013 Summer-Fall; 10(2-3): 204-212.
19	Substituted pyrazoles as hepatoselective HMG-CoA reductase inhibitors: discovery of (3R,5R)-7-[2-(4-fluoro-phenyl)-4-isopropyl-5-(4-methyl-benzylca... J Med Chem. 2008 Jan 10;51(1):31-45.
20	Efficacy, tissue distribution and biliary excretion of methyl (3R,5S)-(E)-3,5-dihydroxy-9,9-diphenyl-6,8-nonadienoate (CP-83101), a hepatoselective inhibitor of HMG-CoA reductase activity in the rat. Biochem Pharmacol. 1990 Sep 15;40(6):1281-93.
21	Studies of cholesterol and bile acid metabolism, and early atherogenesis in hamsters fed GT16-239, a novel bile acid sequestrant (BAS). Atherosclerosis. 1998 Oct;140(2):315-24.
22	Regulation of CYP2B6 and CYP3A expression by hydroxymethylglutaryl coenzyme A inhibitors in primary cultured human hepatocytes. Drug Metab Dispos. 2002 Dec;30(12):1400-5.
23	Determination of SQ 33,600, a phosphinic acid containing HMG CoA reductase inhibitor, in human serum by high-performance liquid chromatography combined with ionspray mass spectrometry. Biol Mass Spectrom. 1992 Apr;21(4):189-94.
24	The novel cholesterol-lowering drug SR-12813 inhibits cholesterol synthesis via an increased degradation of 3-hydroxy-3-methylglutaryl-coenzyme A r... J Biol Chem. 1996 Jun 14;271(24):14376-82.
25	Novel Acetylenic Acids from the Root Bark of Paramacrolobium caeruleum: Inhibitors of 3-Hydroxy-3-methyl-glutaryl Coenzyme A Reductase J. Nat. Prod. 52(1):153-161 (1989).
26	How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
27	Total synthesis and biological evaluation of structural analogues of compactin and dihydromevinolin. J Med Chem. 1987 Oct;30(10):1858-73.
28	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 639).
29	Peptide fragmentation as an approach in modeling of an active peptide and designing a competitive inhibitory peptide for HMG-CoA reductase. Bioorg Med Chem. 2010 Jun 15;18(12):4300-9.
30	Binding effect and design of a competitive inhibitory peptide for HMG-CoA reductase through modeling of an active peptide backbone. Bioorg Med Chem. 2008 Feb 1;16(3):1309-18.
31	Thermodynamic and structure guided design of statin based inhibitors of 3-hydroxy-3-methylglutaryl coenzyme A reductase. J Med Chem. 2008 Jul 10;51(13):3804-13.
32	Synthesis and biological evaluation of dihydroeptastatin, a novel inhibitor of 3-hydroxy-3-methylglutaryl coenzyme A reductase. J Med Chem. 1992 Sep 4;35(18):3388-93.
33	Three-dimensional quantitative structure (3-D QSAR) activity relationship studies on imidazolyl and N-pyrrolyl heptenoates as 3-hydroxy-3-methylglutaryl-CoA reductase (HMGR) inhibitors by comparativemolecular similarity indices analysis (CoMSIA). Bioorg Med Chem Lett. 2005 Feb 15;15(4):1027-32.
34	Synthesis and biological activity of new HMG-CoA reductase inhibitors. 3. Lactones of 6-phenoxy-3,5-dihydroxyhexanoic acids. J Med Chem. 1991 Oct;34(10):2962-83.
35	Discovery of pyrrole-based hepatoselective ligands as potent inhibitors of HMG-CoA reductase. Bioorg Med Chem. 2007 Aug 15;15(16):5576-89.
36	Design and synthesis of novel, conformationally restricted HMG-CoA reductase inhibitors. Bioorg Med Chem Lett. 2007 Aug 15;17(16):4531-7.
37	Design and synthesis of hepatoselective, pyrrole-based HMG-CoA reductase inhibitors. Bioorg Med Chem Lett. 2007 Aug 15;17(16):4538-44.
38	Hepatoselectivity of statins: design and synthesis of 4-sulfamoyl pyrroles as HMG-CoA reductase inhibitors. Bioorg Med Chem Lett. 2008 Feb 1;18(3):1151-6.
39	(3R,5S,E)-7-(4-(4-fluorophenyl)-6-isopropyl-2-(methyl(1-methyl-1h-1,2,4-triazol-5-yl)amino)pyrimidin-5-yl)-3,5-dihydroxyhept-6-enoic acid (BMS-644950): a rationally designed orally efficacious 3-hydroxy-3-methylglutaryl coenzyme-a reductase inhibitor with reduced myotoxicity potential. J Med Chem. 2008 May 8;51(9):2722-33.
40	3-Hydroxy-3-methylglutaryl-coenzyme a reductase inhibitors. 7. Modification of the hexahydronaphthalene moiety of simvastatin: 5-oxygenated and 5-oxa derivatives. J Med Chem. 1991 Aug;34(8):2489-95.
41	Phosphorus-containing inhibitors of HMG-CoA reductase. 2. Synthesis and biological activities of a series of substituted pyridines containing a hydroxyphosphinyl moiety. J Med Chem. 1991 Sep;34(9):2804-15.
42	Application of a 3,3-diphenylpentane skeleton as a multi-template for creation of HMG-CoA reductase inhibitors. Bioorg Med Chem Lett. 2009 Aug 1;19(15):4228-31.
43	Inhibitors of cholesterol biosynthesis. 4. trans-6-[2-(substituted-quinolinyl)ethenyl/ethyl]tetrahydro-4-hydroxy-2 H-pyran-2-ones, a novel series of HMG-CoA reductase inhibitors. J Med Chem. 1991 Jan;34(1):367-73.
44	Relationship between tissue selectivity and lipophilicity for inhibitors of HMG-CoA reductase. J Med Chem. 1991 Jan;34(1):463-6.
45	Inhibitors of cholesterol biosynthesis. 6. trans-6-[2-(2-N-heteroaryl-3,5-disubstituted- pyrazol-4-yl)ethyl/ethenyl]tetrahydro-4-hydroxy-2H-pyran-2-ones. J Med Chem. 1992 May 29;35(11):2095-103.
46	Synthesis and biological activity of new HMG-CoA reductase inhibitors. 2. Derivatives of 7-(1H-pyrrol-3-yl)-substituted-3,5-dihydroxyhept-6(E)-enoic (-heptanoic) acids. J Med Chem. 1990 Jan;33(1):61-70.
47	Phosphorus-containing inhibitors of HMG-CoA reductase. 1. 4-[(2-arylethyl)hydroxyphosphinyl]-3-hydroxy-butanoic acids: a new class of cell-selective inhibitors of cholesterol biosynthesis. J Med Chem. 1990 Nov;33(11):2952-6.
48	Inhibitors of cholesterol biosynthesis. 2. 1,3,5-trisubstituted [2-(tetrahydro-4-hydroxy-2-oxopyran-6-yl)ethyl]pyrazoles. J Med Chem. 1990 Jan;33(1):31-8.
49	Synthesis and biological activity of new HMG-CoA reductase inhibitors. 1. Lactones of pyridine- and pyrimidine-substituted 3,5-dihydroxy-6-heptenoic (-heptanoic) acids. J Med Chem. 1990 Jan;33(1):52-60.
50	Synthesis and biological evaluation of a monocyclic, fully functional analogue of compactin. J Med Chem. 1989 Jan;32(1):197-202.
51	Synthesis and biological activity of bile acid-derived HMG-CoA reductase inhibitors. The role of 21-methyl in recognition of HMG-CoA reductase and the ileal bile acid transport system. J Med Chem. 1994 Sep 30;37(20):3240-6.
52	Inhibitors of cholesterol biosynthesis. 1. 3,5-Dihydroxy-7-(N-imidazolyl)-6-heptenoates and -heptanoates, a novel series of HMG-CoA reductase inhibitors. J Med Chem. 1993 Nov 12;36(23):3646-57.
53	Inhibitors of cholesterol biosynthesis. 2. 3,5-Dihydroxy-7-(N-pyrrolyl)-6-heptenoates, a novel series of HMG-CoA reductase inhibitors. J Med Chem. 1993 Nov 12;36(23):3658-62.
54	HMG-CoA reductase inhibitors: design, synthesis, and biological activity of tetrahydroindazole-substituted 3,5-dihydroxy-6-heptenoic acid sodium salts. J Med Chem. 1993 Nov 12;36(23):3674-85.
55	32-Methyl-32-oxylanosterols: dual-action inhibitors of cholesterol biosynthesis. J Med Chem. 1993 Feb 5;36(3):410-6.
56	Bromophenols in Marine Algae and Their Bioactivities