Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEQ6NC9)

DME Name S-adenosylmethionine synthase 1 (MAT1A)
Synonyms Methionine adenosyltransferase 1; AdoMet synthase 1; Methionine adenosyltransferase I/III; S-adenosylmethionine synthase isoform type-1; AMS1; MAT 1; MAT-I/III; MAT1A; MATA1
Gene Name MAT1A
UniProt ID
METK1_HUMAN
INTEDE ID
DME0189
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
4143
EC Number EC: 2.5.1.6
Transferase
Alkyl/aryl transferase
Alkyl/aryl transferase
EC: 2.5.1.6
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MNGPVDGLCDHSLSEGVFMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVC
KTGMVLLCGEITSMAMVDYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQC
VHLDRNEEDVGAGDQGLMFGYATDETEECMPLTIILAHKLNARMADLRRSGLLPWLRPDS
KTQVTVQYMQDNGAVIPVRIHTIVISVQHNEDITLEEMRRALKEQVIRAVVPAKYLDEDT
VYHLQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGAHGGGAFSGKDYTKVDRSAAYAARW
VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVHKNFDLRPGVI
VRDLDLKKPIYQKTACYGHFGRSEFPWEVPRKLVF
Function
This enzyme catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate.
KEGG Pathway
Biosynthesis of amino acids (hsa01230 )
Cysteine and methionine metabolism (hsa00270 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Metabolism of ingested SeMet, Sec, MeSec into H2Se (R-HSA-2408508 )
Methylation (R-HSA-156581 )
Sulfur amino acid metabolism (R-HSA-1614635 )
Defective MAT1A causes Methionine adenosyltransferase deficiency (MATD) (R-HSA-5579024 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-methionine DME8G1U Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.93E-01 -3.20E-02 -1.16E-01
Alopecia ED70 Skin from scalp 9.13E-01 -3.87E-02 -1.02E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.94E-01 -6.85E-03 -3.83E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 9.42E-01 -1.57E-02 -1.02E-01
Aortic stenosis BB70 Calcified aortic valve 4.45E-01 2.01E-01 5.07E-01
Apnea 7A40 Hyperplastic tonsil 3.44E-01 -4.12E-01 -8.82E-01
Arthropathy FA00-FA5Z Peripheral blood 8.98E-01 1.52E-02 1.10E-01
Asthma CA23 Nasal and bronchial airway 3.77E-03 -9.95E-02 -1.34E-01
Atopic dermatitis EA80 Skin 1.23E-01 -2.30E-01 -9.75E-01
Autism 6A02 Whole blood 1.46E-01 -1.14E-01 -3.26E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.46E-01 -8.92E-02 -4.90E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.86E-01 -1.37E-02 -7.81E-02
Bacterial infection of gingival 1C1H Gingival tissue 3.08E-01 9.06E-03 1.89E-02
Batten disease 5C56.1 Whole blood 6.12E-01 1.04E-01 8.12E-01
Behcet's disease 4A62 Peripheral blood 4.10E-02 2.01E-01 9.67E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.79E-01 -1.09E-01 -5.33E-01
Bladder cancer 2C94 Bladder tissue 7.53E-10 8.02E-01 8.37E+00
Breast cancer 2C60-2C6Z Breast tissue 1.70E-05 -1.32E-01 -2.73E-01
Cardioembolic stroke 8B11.20 Whole blood 6.88E-01 1.75E-02 9.69E-02
Cervical cancer 2C77 Cervical tissue 2.01E-01 -1.00E-01 -3.96E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.99E-01 -1.00E-01 -3.76E-01
Chronic hepatitis C 1E51.1 Whole blood 2.66E-01 4.96E-02 2.46E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.90E-02 6.15E-02 2.06E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.39E-03 1.98E-01 6.03E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.87E-01 -1.10E-01 -3.99E-01
Colon cancer 2B90 Colon tissue 1.59E-17 1.93E-01 6.47E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.42E-01 -4.44E-03 -2.40E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.95E-01 -6.62E-02 -2.91E-01
Endometriosis GA10 Endometrium tissue 3.38E-02 3.28E-01 7.95E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.00E-01 1.37E-01 8.48E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.78E-06 -5.92E-01 -1.53E+00
Gastric cancer 2B72 Gastric tissue 2.25E-01 -2.25E-01 -6.88E-01
Glioblastopma 2A00.00 Nervous tissue 3.99E-06 -1.80E-01 -4.56E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.36E-05 1.11E-01 2.23E+01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.93E-08 -8.75E-01 -3.63E+00
Head and neck cancer 2D42 Head and neck tissue 4.04E-11 -3.59E-01 -8.31E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.74E-01 -2.04E-02 -6.75E-02
Huntington's disease 8A01.10 Whole blood 1.84E-01 1.24E-02 1.22E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.18E-01 1.22E-01 4.16E-01
Immunodeficiency 4A00-4A20 Peripheral blood 3.82E-01 7.11E-02 9.32E-01
Influenza 1E30 Whole blood 8.86E-04 5.23E-01 4.84E+00
Interstitial cystitis GC00.3 Bladder tissue 2.56E-01 2.01E-01 9.89E-01
Intracranial aneurysm 8B01.0 Intracranial artery 6.21E-01 2.31E-02 1.04E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.17E-01 1.82E-02 4.55E-02
Ischemic stroke 8B11 Peripheral blood 5.94E-02 6.02E-02 3.75E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.41E-02 1.00E-01 3.57E-01
Lateral sclerosis 8B60.4 Skin 4.76E-01 -8.20E-02 -3.91E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.28E-01 1.31E-01 4.11E-01
Liver cancer 2C12.0 Liver tissue 1.21E-41 -1.67E+00 -3.60E+00
Liver failure DB99.7-DB99.8 Liver tissue 3.79E-03 -3.84E+00 -1.01E+01
Lung cancer 2C25 Lung tissue 5.44E-01 -1.17E-04 -3.82E-04
Lupus erythematosus 4A40 Whole blood 1.49E-01 -1.24E-01 -1.87E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.86E-01 -1.51E-02 -7.84E-02
Major depressive disorder 6A70-6A7Z Whole blood 5.23E-02 4.89E-02 2.15E-01
Melanoma 2C30 Skin 3.32E-01 5.79E-01 6.64E-01
Multiple myeloma 2A83.1 Peripheral blood 7.95E-01 5.38E-02 2.61E-01
Multiple myeloma 2A83.1 Bone marrow 3.34E-05 -7.26E-01 -3.47E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.33E-01 1.94E-01 6.76E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.03E-01 -5.99E-03 -2.55E-02
Myelofibrosis 2A20.2 Whole blood 1.66E-01 6.87E-02 5.77E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.23E-02 4.65E-01 7.45E-01
Myopathy 8C70.6 Muscle tissue 2.66E-01 -6.79E-02 -3.69E-01
Neonatal sepsis KA60 Whole blood 1.30E-01 -2.68E-02 -7.32E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.48E-04 -1.12E+00 -2.05E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.75E-01 -3.45E-02 -1.68E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.17E-01 8.70E-02 4.06E-01
Olive pollen allergy CA08.00 Peripheral blood 8.26E-02 3.42E-01 1.48E+00
Oral cancer 2B6E Oral tissue 1.36E-04 -4.99E-01 -9.43E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.15E-01 -1.48E-01 -1.51E+00
Osteoporosis FB83.1 Bone marrow 3.97E-02 4.14E-01 6.52E+00
Ovarian cancer 2C73 Ovarian tissue 4.53E-01 -2.54E-01 -5.54E-01
Pancreatic cancer 2C10 Pancreas 7.23E-03 -1.03E+00 -1.24E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 6.47E-01 3.35E-02 1.07E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.70E-01 5.96E-02 4.18E-01
Pituitary cancer 2D12 Pituitary tissue 2.12E-01 -5.48E-02 -1.45E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.14E-01 -1.66E-02 -6.22E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.06E-01 1.14E-01 7.03E-01
Polycythemia vera 2A20.4 Whole blood 2.88E-04 1.47E-01 1.05E+00
Pompe disease 5C51.3 Biceps muscle 2.37E-01 -1.63E-02 -8.81E-02
Preterm birth KA21.4Z Myometrium 8.42E-01 -6.52E-02 -3.32E-01
Prostate cancer 2C82 Prostate 3.94E-04 -1.09E+00 -1.55E+00
Psoriasis EA90 Skin 3.16E-09 -1.44E-01 -3.24E-01
Rectal cancer 2B92 Rectal colon tissue 3.75E-02 1.15E-01 8.42E-01
Renal cancer 2C90-2C91 Kidney 2.60E-03 -6.16E-01 -1.62E+00
Retinoblastoma 2D02.2 Uvea 1.60E-01 1.63E-01 9.38E-01
Rheumatoid arthritis FA20 Synovial tissue 6.80E-01 2.17E-01 1.07E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.54E-01 -3.71E-03 -2.25E-02
Schizophrenia 6A20 Prefrontal cortex 5.63E-01 3.18E-02 7.60E-02
Schizophrenia 6A20 Superior temporal cortex 2.01E-01 -6.25E-02 -5.65E-01
Scleroderma 4A42.Z Whole blood 5.30E-02 -1.78E-01 -8.61E-01
Seizure 8A60-8A6Z Whole blood 6.65E-01 -1.72E-01 -5.85E-01
Sensitive skin EK0Z Skin 9.76E-02 -2.44E-02 -4.80E-01
Sepsis with septic shock 1G41 Whole blood 1.74E-01 6.82E-02 1.68E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.14E-02 5.53E-01 8.39E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.96E-02 1.19E-01 5.81E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.03E-01 -2.94E-02 -2.79E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.81E-01 -1.61E-01 -6.76E-01
Skin cancer 2C30-2C3Z Skin 8.32E-04 -2.52E-01 -4.79E-01
Thrombocythemia 3B63 Whole blood 2.15E-03 1.16E-01 9.24E-01
Thrombocytopenia 3B64 Whole blood 2.72E-01 4.84E-02 2.35E-01
Thyroid cancer 2D10 Thyroid 3.56E-03 4.34E-02 1.60E-01
Tibial muscular dystrophy 8C75 Muscle tissue 6.44E-01 -2.75E-02 -1.49E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.81E-01 1.82E-02 1.08E-01
Type 2 diabetes 5A11 Liver tissue 1.90E-01 -1.87E-01 -6.44E-01
Ureter cancer 2C92 Urothelium 9.77E-01 -3.20E-02 -9.61E-02
Uterine cancer 2C78 Endometrium tissue 2.35E-01 1.44E-01 3.65E-01
Vitiligo ED63.0 Skin 8.55E-01 -1.45E-01 -2.85E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Role of methionine adenosyltransferase 2A and S-adenosylmethionine in mitogen-induced growth of human colon cancer cells. Gastroenterology. 2007 Jul;133(1):207-18.