Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT08KS8J)

• DOT Name: Solute carrier family 45 member 3 (SLC45A3)
• Synonyms: Prostate cancer-associated protein 6; Prostein
• Gene Name: SLC45A3
• UniProt ID: S45A3_HUMAN
• Pfam ID: PF07690
• Sequence:
  MVQRLWVSRLLRHRKAQLLLVNLLTFGLEVCLAAGITYVPPLLLEVGVEEKFMTMVLGIG
  PVLGLVCVPLLGSASDHWRGRYGRRRPFIWALSLGILLSLFLIPRAGWLAGLLCPDPRPL
  ELALLILGVGLLDFCGQVCFTPLEALLSDLFRDPDHCRQAYSVYAFMISLGGCLGYLLPA
  IDWDTSALAPYLGTQEECLFGLLTLIFLTCVAATLLVAEEAALGPTEPAEGLSAPSLSPH
  CCPCRARLAFRNLGALLPRLHQLCCRMPRTLRRLFVAELCSWMALMTFTLFYTDFVGEGL
  YQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFSLVMDRLVQRFGTRAVYLASVA
  AFPVAAGATCLSHSVAVVTASAALTGFTFSALQILPYTLASLYHREKQVFLPKYRGDTGG
  ASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEPTEA
  RVVPGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFATQ
  VVFDKSDLAKYSA
• Function: Proton-associated sucrose transporter. May be able to transport also glucose and fructose.
• Tissue Specificity: Prostate specific. Expressed in all prostatic glandular cells. Expressed both in normal and cancerous prostates.
• KEGG Pathway:
  Transcriptio.l misregulation in cancer (hsa05202)
  MicroR.s in cancer (hsa05206)
• Reactome Pathway: Cellular hexose transport (R-HSA-189200)

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin affects the expression of Solute carrier family 45 member 3 (SLC45A3).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Solute carrier family 45 member 3 (SLC45A3).	[2]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Solute carrier family 45 member 3 (SLC45A3).	[3]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Solute carrier family 45 member 3 (SLC45A3).	[4]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Solute carrier family 45 member 3 (SLC45A3).	[5]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Solute carrier family 45 member 3 (SLC45A3).	[6]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Solute carrier family 45 member 3 (SLC45A3).	[8]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Solute carrier family 45 member 3 (SLC45A3).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Solute carrier family 45 member 3 (SLC45A3).	[7]

References

• [1] Molecular characterization of a toxicological tipping point during human stem cell differentiation. Reprod Toxicol. 2020 Jan;91:1-13. doi: 10.1016/j.reprotox.2019.10.001. Epub 2019 Oct 7.
• [2] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [3] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [4] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [5] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [6] Androgen-induced TOP2B-mediated double-strand breaks and prostate cancer gene rearrangements. Nat Genet. 2010 Aug;42(8):668-75. doi: 10.1038/ng.613. Epub 2010 Jul 4.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [9] Analysis of the prostate cancer cell line LNCaP transcriptome using a sequencing-by-synthesis approach. BMC Genomics. 2006 Sep 29;7:246. doi: 10.1186/1471-2164-7-246.