Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT09T5PO)

DOT Name	Chemokine-like protein TAFA-3 (TAFA3)
Gene Name	TAFA3
UniProt ID	TAFA3_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF12020
Sequence	MSERVERNWSTGGWLLALCLAWLWTHLTLAALQPPTATVLVQQGTCEVIAAHRCCNRNRI EERSQTVKCSCFSGQVAGTTRAKPSCVDASIVLQRWWCQMEPCLPGEECKVLPDLSGWSC SSGHKVKTTKVTR
Function	Plays a role in the regulation of microglia polarization.
Tissue Specificity	Brain-specific.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Chemokine-like protein TAFA-3 (TAFA3).	[1]
Permethrin	DMZ0Q1G	Approved	Permethrin decreases the expression of Chemokine-like protein TAFA-3 (TAFA3).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Chemokine-like protein TAFA-3 (TAFA3).	[3]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Chemokine-like protein TAFA-3 (TAFA3).	[4]
------------------------------------------------------------------------------------

References

1	Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
2	Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
3	Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
4	Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.