Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0EJCL0)

DOT Name	Probable crossover junction endonuclease EME2 (EME2)
Synonyms	EC 3.1.22.-
Gene Name	EME2
Related Disease	Combined oxidative phosphorylation deficiency 32 ( )
UniProt ID	EME2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	7F6L
EC Number	3.1.22.-
Pfam ID	PF21292 ; PF02732
Sequence	MARVGPGRAGVSCQGRGRGRGGSGQRRPPTWEISDSDAEDSAGSEAAARARDPAGERRAA AEALRLLRPEQVLKRLAVCVDTAILEDAGADVLMEALEALGCECRIEPQRPARSLRWTRA SPDPCPRSLPPEVWAAGEQELLLLLEPEEFLQGVATLTQISGPTHWVPWISPETTARPHL AVIGLDAYLWSRQHVSRGTQQPESPKVAGAEVAVSWPEVEEALVLLQLWANLDVLLVASW QELSRHVCAVTKALAQYPLKQYRESQAFSFCTAGRWAAGEPVARDGAGLQAAWRRQIRQF SRVSPAVADAVVTAFPSPRLLQQALEACSTERERMGLLADLPVPPSEGGRPRRVGPDLSR RICLFLTTANPDLLLDLGS
Function	Interacts with MUS81 to form a DNA structure-specific endonuclease which cleaves substrates such as 3'-flap structures.
KEGG Pathway	Fanconi anemia pathway (hsa03460 )
Reactome Pathway	Fanconi Anemia Pathway (R-HSA-6783310 ) Resolution of D-loop Structures through Holliday Junction Intermediates (R-HSA-5693568 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Combined oxidative phosphorylation deficiency 32	DISHJMNW	Strong	Genetic Variation	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Probable crossover junction endonuclease EME2 (EME2).	[2]
------------------------------------------------------------------------------------

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Probable crossover junction endonuclease EME2 (EME2).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Probable crossover junction endonuclease EME2 (EME2).	[4]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Probable crossover junction endonuclease EME2 (EME2).	[5]
------------------------------------------------------------------------------------

References

1	Biallelic Mutations in MRPS34 Lead to Instability of the Small Mitoribosomal Subunit and Leigh Syndrome. Am J Hum Genet. 2017 Aug 3;101(2):239-254. doi: 10.1016/j.ajhg.2017.07.005.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
4	Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
5	17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.