Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0RYJHE)

DOT Name Killer cell lectin-like receptor subfamily G member 1 (KLRG1)
Synonyms C-type lectin domain family 15 member A; ITIM-containing receptor MAFA-L; MAFA-like receptor; Mast cell function-associated antigen
Gene Name KLRG1
UniProt ID
KLRG1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3FF7
Pfam ID
PF00059
Sequence
MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWIL
CQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMS
LLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPL
HWVCKKCPFADQALF
Function
Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells.
Tissue Specificity Expressed specifically on natural killer (NK) cells and T-cells, mainly CD8 T-cells.
Reactome Pathway
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Killer cell lectin-like receptor subfamily G member 1 (KLRG1). [1]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Killer cell lectin-like receptor subfamily G member 1 (KLRG1). [3]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Killer cell lectin-like receptor subfamily G member 1 (KLRG1). [2]
------------------------------------------------------------------------------------

References

1 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
2 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
3 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.