| DOT Name |
T-cell surface glycoprotein CD3 epsilon chain (CD3E)
|
| Synonyms |
T-cell surface antigen T3/Leu-4 epsilon chain; CD antigen CD3e |
| Gene Name |
CD3E
|
| Related Disease |
- Immunodeficiency 18 ( )
- T-B+ severe combined immunodeficiency due to CD3delta/CD3epsilon/CD3zeta ( )
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
1A81 ; 1SY6 ; 1XIW ; 2ROL ; 5QU2 ; 6JXR ; 7FJD ; 7FJE ; 7FJF ; 7PHR ; 8ES7 ; 8ES8 ; 8ES9 ; 8F0L |
| Pfam ID |
|
| Sequence |
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQ
HNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCE
NCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERP
PPVPNPDYEPIRKGQRDLYSGLNQRRI
|
| Function |
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.
|
| KEGG Pathway |
- Hematopoietic cell lineage (hsa04640 )
- Th1 and Th2 cell differentiation (hsa04658 )
- Th17 cell differentiation (hsa04659 )
- T cell receptor sig.ling pathway (hsa04660 )
- Chagas disease (hsa05142 )
- Measles (hsa05162 )
- Human T-cell leukemia virus 1 infection (hsa05166 )
- Epstein-Barr virus infection (hsa05169 )
- Human immunodeficiency virus 1 infection (hsa05170 )
- PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 )
- Primary immunodeficiency (hsa05340 )
|
| Reactome Pathway |
- Downstream TCR signaling (R-HSA-202424 )
- Phosphorylation of CD3 and TCR zeta chains (R-HSA-202427 )
- Translocation of ZAP-70 to Immunological synapse (R-HSA-202430 )
- Generation of second messenger molecules (R-HSA-202433 )
- PD-1 signaling (R-HSA-389948 )
- Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 )
|
|
|
|
|
|
|
