Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1FSPX2)

• DOT Name: Pancreatic progenitor cell differentiation and proliferation factor-like protein (PPDPFL)
• Synonyms: Exocrine differentiation and proliferation factor-like protein
• Gene Name: PPDPFL
• UniProt ID: PDPFL_HUMAN
• Pfam ID: PF15060
• Sequence:
  MASVPSIGCLLARNQYYRKSSVSSVSSLTSSDSVNFIDDDKPQQGLPEVAESTWWFKSFF
  HSEPVLSNVRIKDLSATGSLSGRS

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Pancreatic progenitor cell differentiation and proliferation factor-like protein (PPDPFL).	[1]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Pancreatic progenitor cell differentiation and proliferation factor-like protein (PPDPFL).	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Pancreatic progenitor cell differentiation and proliferation factor-like protein (PPDPFL).	[3]

References

• [1] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [2] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.