Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT1FSPX2)
DOT Name | Pancreatic progenitor cell differentiation and proliferation factor-like protein (PPDPFL) | ||||
---|---|---|---|---|---|
Synonyms | Exocrine differentiation and proliferation factor-like protein | ||||
Gene Name | PPDPFL | ||||
UniProt ID | |||||
3D Structure | |||||
Pfam ID | |||||
Sequence |
MASVPSIGCLLARNQYYRKSSVSSVSSLTSSDSVNFIDDDKPQQGLPEVAESTWWFKSFF
HSEPVLSNVRIKDLSATGSLSGRS |
||||
Molecular Interaction Atlas (MIA) of This DOT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
2 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
||||||||||||||||||||||||||||||
References