Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1G3HAF)

DOT Name	Dynein light chain roadblock-type 2 (DYNLRB2)
Synonyms	Dynein light chain 2B, cytoplasmic; Roadblock domain-containing protein 2
Gene Name	DYNLRB2
Related Disease	Hepatocellular carcinoma ( ) leukaemia ( ) Leukemia ( )
UniProt ID	DLRB2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	8J07
Pfam ID	PF03259
Sequence	MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDI DPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQNPCE
Function	Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.
Tissue Specificity	High expression in heart, brain, placenta, skeletal muscle, prostate and small intestine; moderate in kidney, pancreas, spleen, testis, ovary and colon; low in lung, liver, thymus and leukocyte.
KEGG Pathway	Motor proteins (hsa04814 ) Salmonella infection (hsa05132 )
Reactome Pathway	Intraflagellar transport (R-HSA-5620924 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[1]
leukaemia	DISS7D1V	moderate	Biomarker	[2]
Leukemia	DISNAKFL	moderate	Biomarker	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Dynein light chain roadblock-type 2 (DYNLRB2).	[3]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Dynein light chain roadblock-type 2 (DYNLRB2).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Dynein light chain roadblock-type 2 (DYNLRB2).	[5]
------------------------------------------------------------------------------------

References

1	Identification of two novel human dynein light chain genes, DNLC2A and DNLC2B, and their expression changes in hepatocellular carcinoma tissues from 68 Chinese patients.Gene. 2001 Dec 27;281(1-2):103-13. doi: 10.1016/s0378-1119(01)00787-9.
2	Functional Evidence of the Involvement of the Dynein Light Chain DYNLRB2 in Murine Leukemia Virus Infection.J Virol. 2017 Apr 28;91(10):e00129-17. doi: 10.1128/JVI.00129-17. Print 2017 May 15.
3	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
4	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
5	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.