Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1NVQGP)

• DOT Name: Single-pass membrane and coiled-coil domain-containing protein 2 (SMCO2)
• Gene Name: SMCO2
• Related Disease: Obstructive sleep apnea
• UniProt ID: SMCO2_HUMAN
• Sequence:
  MALTPTNLNNKMSLQMKMDCQEQQLTKKNNGFFQKLNVTEGAMQDLLKEIIKVDHILDRS
  DDEDDISSENPQTDFLHKGMLELEAEHDQDLSKQDKQETDVDEDPQASTSLQFSKKNLLE
  LCLKGMFLKLNYWNTKIGLQVKELGADYIDGTEKIDNIIKKINVTENTVKSLLKDMLTLK
  GQIEKLEDRGLDLDQGTSTEVNTCNEVYELKKKVIERLEDLCKNVELLSAKLRMYQMEAE
  DTDSHSSEEIDTEEMEALLPQAPASFLVQKSPPRNTAWKRALRIFIMFDVLTVTGLLCYI
  LFFGATFLFERVLLRMLGCRTTWDLREMREPFLNLEVEALLPS

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Obstructive sleep apnea	DIS0SVD1	Strong	Genetic Variation	[1]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Single-pass membrane and coiled-coil domain-containing protein 2 (SMCO2).	[2]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Single-pass membrane and coiled-coil domain-containing protein 2 (SMCO2).	[3]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Single-pass membrane and coiled-coil domain-containing protein 2 (SMCO2).	[4]

References

• [1] Genetic Associations with Obstructive Sleep Apnea Traits in Hispanic/Latino Americans.Am J Respir Crit Care Med. 2016 Oct 1;194(7):886-897. doi: 10.1164/rccm.201512-2431OC.
• [2] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [3] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [4] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.