Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT22LO44)

• DOT Name: DPY30 domain-containing protein 2 (DYDC2)
• Gene Name: DYDC2
• UniProt ID: DYDC2_HUMAN
• PDB ID: 8J07
• Pfam ID: PF05186
• Sequence:
  METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEE
  YDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQE
  FLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of DPY30 domain-containing protein 2 (DYDC2).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of DPY30 domain-containing protein 2 (DYDC2).	[5]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of DPY30 domain-containing protein 2 (DYDC2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of DPY30 domain-containing protein 2 (DYDC2).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of DPY30 domain-containing protein 2 (DYDC2).	[4]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of DPY30 domain-containing protein 2 (DYDC2).	[2]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of DPY30 domain-containing protein 2 (DYDC2).	[6]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of DPY30 domain-containing protein 2 (DYDC2).	[7]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [7] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.