Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT254UDW)

DOT Name	Protein NipSnap homolog 3A (NIPSNAP3A)
Synonyms	NipSnap3A; Protein NipSnap homolog 4; NipSnap4; Target for Salmonella secreted protein C; TassC
Gene Name	NIPSNAP3A
UniProt ID	NPS3A_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF07978
Sequence	MLVLRSALTRALASRTLAPQMCSSFATGPRQYDGIFYEFRSYYLKPSKMNEFLENFEKNA HLRTAHSELVGYWSVEFGGRMNTVFHIWKYDNFAHRTEVRKALAKDKEWQEQFLIPNLAL IDKQESEITYLVPWCKLEKPPKEGVYELATFQMKPGGPALWGDAFKRAVHAHVNLGYTKL VGVFHTEYGALNRVHVLWWNESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIP TSFSPLK
Tissue Specificity	Ubiquitous. Highly expressed in liver, kidney and muscle. Expressed at intermediate level in brain, heart, colon, thymus, kidney, small intestine, placenta, lung, leukocytes and spleen.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein NipSnap homolog 3A (NIPSNAP3A).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Protein NipSnap homolog 3A (NIPSNAP3A).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein NipSnap homolog 3A (NIPSNAP3A).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Protein NipSnap homolog 3A (NIPSNAP3A).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Protein NipSnap homolog 3A (NIPSNAP3A).	[5]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Protein NipSnap homolog 3A (NIPSNAP3A).	[6]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Protein NipSnap homolog 3A (NIPSNAP3A).	[7]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Protein NipSnap homolog 3A (NIPSNAP3A).	[8]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Protein NipSnap homolog 3A (NIPSNAP3A).	[9]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Protein NipSnap homolog 3A (NIPSNAP3A).	[10]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Protein NipSnap homolog 3A (NIPSNAP3A).	[11]
------------------------------------------------------------------------------------


⏷ Show the Full List of 11 Drug(s)

References

1	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2	Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
3	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4	Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
5	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
6	Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
7	Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
8	Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
9	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
10	Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
11	Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.