Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2H4HAP)

DOT Name	Putative transmembrane protein INAFM2 (INAFM2)
Synonyms	InaF-motif-containing protein 2; Osteogenesis up-regulated transcript 1
Gene Name	INAFM2
Related Disease	Adult lymphoma ( ) AIDS-related lymphoma ( ) Lymphoma ( ) Pediatric lymphoma ( )
UniProt ID	INAM2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15018
Sequence	MKERDAAPAERGKPATYTGDKKAKMAAKTNKKWVRLATVFAYVLSVSLAAIVLAVYYSLI WQPVGAGTSGGAAGPPPGGSNATGPSGTSGAAAAGPNTTGSSRREAPRDVPPLQAARPAP PEPPADSPPAGPLERPRGPDEDEEETAAAPGSR

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Adult lymphoma	DISK8IZR	Strong	Biomarker	[1]
AIDS-related lymphoma	DISSLRAU	Strong	Biomarker	[1]
Lymphoma	DISN6V4S	Strong	Biomarker	[1]
Pediatric lymphoma	DIS51BK2	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Putative transmembrane protein INAFM2 (INAFM2).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Putative transmembrane protein INAFM2 (INAFM2).	[3]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Putative transmembrane protein INAFM2 (INAFM2).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Putative transmembrane protein INAFM2 (INAFM2).	[5]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Putative transmembrane protein INAFM2 (INAFM2).	[2]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Putative transmembrane protein INAFM2 (INAFM2).	[6]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Drug(s)

References

1	Establishment and characterization of a novel VEGF-producing HHV-8-unrelated PEL-like lymphoma cell line, OGU1.Eur J Haematol. 2016 Feb;96(2):144-51. doi: 10.1111/ejh.12559. Epub 2015 Apr 21.
2	A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
3	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
4	Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
5	Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
6	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.