Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2M9WWQ)

DOT Name	Putative inactive neutral ceramidase B (ASAH2B)
Synonyms	ASAH2-like protein; Putative inactive N-acylsphingosine amidohydrolase 2B; Putative inactive non-lysosomal ceramidase B
Gene Name	ASAH2B
Related Disease	Breast cancer ( ) Breast carcinoma ( )
UniProt ID	ASA2B_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF17048
Sequence	MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVI FVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEW HIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI
Tissue Specificity	Ubiquitous. Expression is reduced with increasing age and in late-onset Alzheimer disease (LOAD) patients. This reduction is even more pronounced in patients with an affected mother.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Breast cancer	DIS7DPX1	Strong	Biomarker	[1]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Putative inactive neutral ceramidase B (ASAH2B).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Putative inactive neutral ceramidase B (ASAH2B).	[6]
------------------------------------------------------------------------------------

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen affects the expression of Putative inactive neutral ceramidase B (ASAH2B).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Putative inactive neutral ceramidase B (ASAH2B).	[4]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Putative inactive neutral ceramidase B (ASAH2B).	[5]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Putative inactive neutral ceramidase B (ASAH2B).	[7]
------------------------------------------------------------------------------------

References

1	Silencing lnc-ASAH2B-2 Inhibits Breast Cancer Cell Growth via the mTOR Pathway.Anticancer Res. 2018 Jun;38(6):3427-3434. doi: 10.21873/anticanres.12611.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
4	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
6	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
7	Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.