General Information of Drug Off-Target (DOT) (ID: OT3IZ61B)

DOT Name COMM domain-containing protein 9 (COMMD9)
Gene Name COMMD9
Related Disease
Non-small-cell lung cancer ( )
UniProt ID
COMD9_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4NKN; 4OE9; 6BP6; 8ESD; 8F2R; 8F2U
Pfam ID
PF07258 ; PF20923
Sequence
MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEEL
LQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISL
PRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDT
MLDGLGRIRDQLSAVASK
Function
May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. May down-regulate activation of NF-kappa-B. Modulates Na(+) transport in epithelial cells by regulation of apical cell surface expression of amiloride-sensitive sodium channel (ENaC) subunits.
Tissue Specificity Ubiquitous.
Reactome Pathway
Neddylation (R-HSA-8951664 )
Neutrophil degranulation (R-HSA-6798695 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of COMM domain-containing protein 9 (COMMD9). [2]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of COMM domain-containing protein 9 (COMMD9). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of COMM domain-containing protein 9 (COMMD9). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of COMM domain-containing protein 9 (COMMD9). [5]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of COMM domain-containing protein 9 (COMMD9). [6]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of COMM domain-containing protein 9 (COMMD9). [7]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol decreases the expression of COMM domain-containing protein 9 (COMMD9). [8]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of COMM domain-containing protein 9 (COMMD9). [10]
GALLICACID DM6Y3A0 Investigative GALLICACID increases the expression of COMM domain-containing protein 9 (COMMD9). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of COMM domain-containing protein 9 (COMMD9). [9]
------------------------------------------------------------------------------------

References

1 COMMD9 promotes TFDP1/E2F1 transcriptional activity via interaction with TFDP1 in non-small cell lung cancer.Cell Signal. 2017 Jan;30:59-66. doi: 10.1016/j.cellsig.2016.11.016. Epub 2016 Nov 19.
2 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
8 Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
9 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
10 Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
11 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.