Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT46U1WM)

• DOT Name: Beta-crystallin A2 (CRYBA2)
• Synonyms: Beta-A2 crystallin
• Gene Name: CRYBA2
• Related Disease:
  Cataract 42
  Early-onset anterior polar cataract
  Early-onset nuclear cataract
• UniProt ID: CRBA2_HUMAN
• Pfam ID: PF00030
• Sequence:
  MSSAPAPGPAPASLTLWDEEDFQGRRCRLLSDCANVCERGGLPRVRSVKVENGVWVAFEY
  PDFQGQQFILEKGDYPRWSAWSGSSSHNSNQLLSFRPVLCANHNDSRVTLFEGDNFQGCK
  FDLVDDYPSLPSMGWASKDVGSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFCTYGEL
  GTQAHTGQLQSIRRVQH
• Function: Crystallins are the dominant structural components of the vertebrate eye lens.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cataract 42	DISDNYYA	Strong	Autosomal dominant	[1]
Early-onset anterior polar cataract	DISTOPIY	Supportive	Autosomal dominant	[2]
Early-onset nuclear cataract	DISGIHUY	Supportive	Autosomal dominant	[2]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Beta-crystallin A2 (CRYBA2).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Beta-crystallin A2 (CRYBA2).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Beta-crystallin A2 (CRYBA2).	[5]

References

• [1] Targeted Exome Sequencing of Congenital Cataracts Related Genes: Broadening the Mutation Spectrum and Genotype-Phenotype Correlations in 27 Chinese Han Families. Sci Rep. 2017 Apr 27;7(1):1219. doi: 10.1038/s41598-017-01182-9.
• [2] Whole exome sequencing in dominant cataract identifies a new causative factor, CRYBA2, and a variety of novel alleles in known genes. Hum Genet. 2013 Jul;132(7):761-70. doi: 10.1007/s00439-013-1289-0. Epub 2013 Mar 19.
• [3] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [4] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.