Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT47CHQR)
| DOT Name | Spermatogenesis-associated protein 19, mitochondrial (SPATA19) | ||||
|---|---|---|---|---|---|
| Synonyms | Spermatogenic cell-specific gene 1 protein; Spergen-1 | ||||
| Gene Name | SPATA19 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MIITTWIVYILARKGVGLPFLPITSSDIDVVESEAVSVLHHWLKKTEEEASRGIKEKLSI
NHPSQGVREKMSTDSPPTHGQDIHVTRDVVKHHLSKSDLLANQSQEVLEERTRIQFIRWS HTRIFQVPSEMTEDIMRDRIEQVRRSISRLTDVSAQDFSMRPSSSDC |
||||
| Function |
Essential for sperm motility and male fertility. Plays an important role in sperm motility by regulating the organization and function of the mitochondria and is also required for correct sperm midpiece assembly.
|
||||
| Tissue Specificity | Expressed specifically in testis. | ||||
Molecular Interaction Atlas (MIA) of This DOT
|
8 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
