Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT488053)

DOT Name Sperm acrosome membrane-associated protein 4 (SPACA4)
Synonyms Sperm acrosomal membrane-associated protein 14
Gene Name SPACA4
UniProt ID
SACA4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00021
Sequence
MVLCWLLLLVMALPPGTTGVKDCVFCELTDSMQCPGTYMHCGDDEDCFTGHGVAPGTGPV
INKGCLRATSCGLEEPVSYRGVTYSLTTNCCTGRLCNRAPSSQTVGATTSLALGLGMLLP
PRLL
Function Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization.
Tissue Specificity Testis specific . Expressed in spermatozoa .
Reactome Pathway
Post-translational modification (R-HSA-163125 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Sperm acrosome membrane-associated protein 4 (SPACA4). [1]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Sperm acrosome membrane-associated protein 4 (SPACA4). [2]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Sperm acrosome membrane-associated protein 4 (SPACA4). [3]
------------------------------------------------------------------------------------

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
3 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.