Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4BMIYV)

DOT Name Cytochrome c oxidase assembly factor 3 homolog, mitochondrial (COA3)
Synonyms Coiled-coil domain-containing protein 56; Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 12 kDa
Gene Name COA3
Related Disease
Cardiovascular disease ( )
Cytochrome-c oxidase deficiency disease ( )
Mitochondrial complex 4 deficiency, nuclear type 14 ( )
Mitochondrial disease ( )
UniProt ID
COA3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF09813
Sequence
MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVT
GLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGS
Function
Core component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly. MITRAC complexes regulate both translation of mitochondrial encoded components and assembly of nuclear-encoded components imported in mitochondrion. Required for efficient translation of MT-CO1 and mitochondrial respiratory chain complex IV assembly.
KEGG Pathway
Thermogenesis (hsa04714 )

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cardiovascular disease DIS2IQDX moderate Genetic Variation [1]
Cytochrome-c oxidase deficiency disease DISK7N3G Supportive Autosomal recessive [2]
Mitochondrial complex 4 deficiency, nuclear type 14 DISAVUAD Limited Unknown [2]
Mitochondrial disease DISKAHA3 Limited Autosomal recessive [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Cytochrome c oxidase assembly factor 3 homolog, mitochondrial (COA3). [4]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Cytochrome c oxidase assembly factor 3 homolog, mitochondrial (COA3). [5]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Cytochrome c oxidase assembly factor 3 homolog, mitochondrial (COA3). [6]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Cytochrome c oxidase assembly factor 3 homolog, mitochondrial (COA3). [7]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Cytochrome c oxidase assembly factor 3 homolog, mitochondrial (COA3). [8]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Cytochrome c oxidase assembly factor 3 homolog, mitochondrial (COA3). [9]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Cytochrome c oxidase assembly factor 3 homolog, mitochondrial (COA3). [10]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Cytochrome c oxidase assembly factor 3 homolog, mitochondrial (COA3). [11]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Cytochrome c oxidase assembly factor 3 homolog, mitochondrial (COA3). [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 MDR reversal and pro-apoptotic effects of statins and statins combined with flavonoids in colon cancer cells.Biomed Pharmacother. 2019 Jan;109:1511-1522. doi: 10.1016/j.biopha.2018.10.169. Epub 2018 Nov 14.
2 Mutations in COA3 cause isolated complex IV deficiency associated with neuropathy, exercise intolerance, obesity, and short stature. J Med Genet. 2015 Mar;52(3):203-7. doi: 10.1136/jmedgenet-2014-102914. Epub 2015 Jan 20.
3 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
4 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
5 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
6 Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
7 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
8 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
9 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
10 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
11 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
12 Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.