Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4C7XNK)

DOT Name Serine/threonine-protein kinase PRP4 homolog (PRP4K)
Synonyms EC 2.7.11.1; PRP4 kinase; PRP4 pre-mRNA-processing factor 4 homolog
Gene Name PRP4K
UniProt ID
PRP4B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4IAN; 4IFC; 4IIR; 4IJP; 6CNH; 6PJJ; 6PK6; 6QX9
EC Number
2.7.11.1
Pfam ID
PF00069
Sequence
MAAAETQSLREQPEMEDANSEKSINEENGEVSEDQSQNKHSRHKKKKHKHRSKHKKHKHS
SEEDKDKKHKHKHKHKKHKRKEIIDASDKEGMSPAKRTKLDDLALLEDLEKQRALIKAEL
DNELMEGKVQSGMGLILQGYESGSEEEGEIHEKARNGNRSSTRSSSTKGKLELVDNKITT
KKRSKSRSKERTRHRSDKKKSKGGIEIVKEKTTRSKSKERKKSKSPSKRSKSQDQARKSK
SPTLRRRSQEKIGKARSPTDDKVKIEDKSKSKDRKKSPIINESRSRDRGKKSRSPVDLRG
KSKDRRSRSKERKSKRSETDKEKKPIKSPSKDASSGKENRSPSRRPGRSPKRRSLSPKPR
DKSRRSRSPLLNDRRSKQSKSPSRTLSPGRRAKSRSLERKRREPERRRLSSPRTRPRDDI
LSRRERSKDASPINRWSPTRRRSRSPIRRRSRSPLRRSRSPRRRSRSPRRRDRGRRSRSR
LRRRSRSRGGRRRRSRSKVKEDKFKGSLSEGMKVEQESSSDDNLEDFDVEEEDEEALIEQ
RRIQRQAIVQKYKYLAEDSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENV
DTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMFTESDDMFAAYFDSARLRAAGIGKDFKE
NPNLRDNWTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIR
NNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLREVLKK
YGKDVGLHIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILVNESKTILKLCDFGSASH
VADNDITPYLVSRFYRAPEIIIGKSYDYGIDMWSVGCTLYELYTGKILFPGKTNNHMLKL
AMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLI
GCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQEKI
Function Has a role in pre-mRNA splicing. Phosphorylates SF2/ASF.
Tissue Specificity Ubiquitous.
Reactome Pathway
mRNA Splicing - Major Pathway (R-HSA-72163 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
14 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Serine/threonine-protein kinase PRP4 homolog (PRP4K). [1]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Serine/threonine-protein kinase PRP4 homolog (PRP4K). [2]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Serine/threonine-protein kinase PRP4 homolog (PRP4K). [3]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Serine/threonine-protein kinase PRP4 homolog (PRP4K). [4]
Selenium DM25CGV Approved Selenium decreases the expression of Serine/threonine-protein kinase PRP4 homolog (PRP4K). [5]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol decreases the expression of Serine/threonine-protein kinase PRP4 homolog (PRP4K). [6]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of Serine/threonine-protein kinase PRP4 homolog (PRP4K). [7]
Indomethacin DMSC4A7 Approved Indomethacin decreases the expression of Serine/threonine-protein kinase PRP4 homolog (PRP4K). [8]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Serine/threonine-protein kinase PRP4 homolog (PRP4K). [9]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Serine/threonine-protein kinase PRP4 homolog (PRP4K). [11]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Serine/threonine-protein kinase PRP4 homolog (PRP4K). [13]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Serine/threonine-protein kinase PRP4 homolog (PRP4K). [14]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Serine/threonine-protein kinase PRP4 homolog (PRP4K). [15]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Serine/threonine-protein kinase PRP4 homolog (PRP4K). [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
TAK-243 DM4GKV2 Phase 1 TAK-243 decreases the sumoylation of Serine/threonine-protein kinase PRP4 homolog (PRP4K). [10]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Serine/threonine-protein kinase PRP4 homolog (PRP4K). [12]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Serine/threonine-protein kinase PRP4 homolog (PRP4K). [12]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
3 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
4 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
5 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
6 Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
7 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
8 Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
9 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
10 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
11 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
12 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
13 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
14 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
15 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
16 Transcriptomic alterations induced by Ochratoxin A in rat and human renal proximal tubular in vitro models and comparison to a rat in vivo model. Arch Toxicol. 2012 Apr;86(4):571-89.