Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT4X45JZ)
| DOT Name | Membrane-spanning 4-domains subfamily A member 7 (MS4A7) | ||||
|---|---|---|---|---|---|
| Synonyms | CD20 antigen-like 4; CD20/FC-epsilon-RI-beta family member 4; Four-span transmembrane protein 2 | ||||
| Gene Name | MS4A7 | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLIS
SLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTS NAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVS LTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI |
||||
| Function | May be involved in signal transduction as a component of a multimeric receptor complex. | ||||
| Tissue Specificity |
Ubiquitous expression in normal tissues. Expression is more elevated in adult liver, lung, spleen, and heart than in their fetal counterparts, and is higher in normal tissues than in the cancerous tissue or cell lines. Low levels of expression were detected in the promonocytic stage, whereas high levels of expression were detected in mature monocytes.
|
||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
8 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
