Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT56IBFQ)

• DOT Name: Putative protein PRAC2 (PRAC2)
• Synonyms: Prostate, rectum and colon expressed gene protein 2
• Gene Name: PRAC2
• Related Disease:
  Breast cancer
  Breast carcinoma
  Glioma
  Neoplasm
  Prostate cancer
  Prostate carcinoma
• UniProt ID: PRAC2_HUMAN
• Sequence:
  MDRRRMALRPGSRRPTAFFFHSRWLVPNLLAFFLGLSGAGPIHLPMPWPNGRRHRVLDPH
  TQLSTHEAPGRWKPVAPRTMKACPQVLLEW
• Tissue Specificity: Highly expressed in prostate and testis. Also detected in placenta, muscle, colon, peripheral blood leukocytes and skin.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Biomarker	[1]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[1]
Glioma	DIS5RPEH	Strong	Posttranslational Modification	[2]
Neoplasm	DISZKGEW	Strong	Biomarker	[2]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[3]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[3]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Putative protein PRAC2 (PRAC2).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Putative protein PRAC2 (PRAC2).	[6]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Putative protein PRAC2 (PRAC2).	[5]

References

• [1] Roadmap of DNA methylation in breast cancer identifies novel prognostic biomarkers.BMC Cancer. 2019 Mar 12;19(1):219. doi: 10.1186/s12885-019-5403-0.
• [2] Long noncoding RNA HOXB13-AS1 regulates HOXB13 gene methylation by interacting with EZH2 in glioma.Cancer Med. 2018 Sep;7(9):4718-4728. doi: 10.1002/cam4.1718. Epub 2018 Aug 13.
• [3] Inflammation-associated DNA methylation patterns in epithelium of ulcerative colitis.Epigenetics. 2017 Aug;12(8):591-606. doi: 10.1080/15592294.2017.1334023. Epub 2017 May 30.
• [4] Effect of prenatal arsenic exposure on DNA methylation and leukocyte subpopulations in cord blood. Epigenetics. 2014 May;9(5):774-82. doi: 10.4161/epi.28153. Epub 2014 Feb 13.
• [5] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.