Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5DI4DL)

DOT Name Mitochondrial nicotinamide adenine dinucleotide transporter SLC25A52 (SLC25A52)
Synonyms Mitochondrial NAD(+) transporter SLC25A52; Mitochondrial carrier triple repeat protein 2; Solute carrier family 25 member 52
Gene Name SLC25A52
Related Disease
Breast cancer ( )
Breast carcinoma ( )
UniProt ID
S2552_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00153
Sequence
MIDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITYPIQKVLFRQQL
YGIKTRDAVLQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLRKHVRAPEFAT
HGVAAVLAGTAEAIFTPLERVQTLLQNHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPIL
FRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFIGGGLLGAMLGFLCFPINVVKTRLQ
SQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKFI
Function
Mitochondrial membrane carrier protein that mediates the import of NAD(+) into mitochondria. Compared to SLC25A51, SLC25A52-mediated transport is not essential for the import of NAD(+) in mitochondria. The transport mechanism, uniport or antiport, its electrogenicity and substrate selectivity, remain to be elucidated.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 moderate Genetic Variation [1]
Breast carcinoma DIS2UE88 moderate Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Mitochondrial nicotinamide adenine dinucleotide transporter SLC25A52 (SLC25A52). [2]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Mitochondrial nicotinamide adenine dinucleotide transporter SLC25A52 (SLC25A52). [3]
------------------------------------------------------------------------------------

References

1 Genetic modifiers of menopausal hormone replacement therapy and breast cancer risk: a genome-wide interaction study.Endocr Relat Cancer. 2013 Nov 4;20(6):875-87. doi: 10.1530/ERC-13-0349. Print 2013 Dec.
2 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
3 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.