Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5EGV3F)

DOT Name Polyamine-transporting ATPase 13A3 (ATP13A3)
Synonyms ATPase family homolog up-regulated in senescence cells 1; Putrescine transporting ATPase; EC 7.6.2.16
Gene Name ATP13A3
Related Disease
Pulmonary arterial hypertension ( )
Carcinoma ( )
Heritable pulmonary arterial hypertension ( )
UniProt ID
AT133_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
7.6.2.16
Pfam ID
PF13246 ; PF00690 ; PF00122 ; PF12409
Sequence
MDREERKTINQGQEDEMEIYGYNLSRWKLAIVSLGVICSGGFLLLLLYWMPEWRVKATCV
RAAIKDCEVVLLRTTDEFKMWFCAKIRVLSLETYPVSSPKSMSNKLSNGHAVCLIENPTE
ENRHRISKYSQTESQQIRYFTHHSVKYFWNDTIHNFDFLKGLDEGVSCTSIYEKHSAGLT
KGMHAYRKLLYGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSTDEYYYYALAIVV
MSIVSIVSSLYSIRKQYVMLHDMVATHSTVRVSVCRVNEEIEEIFSTDLVPGDVMVIPLN
GTIMPCDAVLINGTCIVNESMLTGESVPVTKTNLPNPSVDVKGIGDELYNPETHKRHTLF
CGTTVIQTRFYTGELVKAIVVRTGFSTSKGQLVRSILYPKPTDFKLYRDAYLFLLCLVAV
AGIGFIYTIINSILNEVQVGVIIIESLDIITITVPPALPAAMTAGIVYAQRRLKKIGIFC
ISPQRINICGQLNLVCFDKTGTLTEDGLDLWGIQRVENARFLSPEENVCNEMLVKSQFVA
CMATCHSLTKIEGVLSGDPLDLKMFEAIGWILEEATEEETALHNRIMPTVVRPPKQLLPE
STPAGNQEMELFELPATYEIGIVRQFPFSSALQRMSVVARVLGDRKMDAYMKGAPEAIAG
LCKPETVPVDFQNVLEDFTKQGFRVIALAHRKLESKLTWHKVQNISRDAIENNMDFMGLI
IMQNKLKQETPAVLEDLHKANIRTVMVTGDSMLTAVSVARDCGMILPQDKVIIAEALPPK
DGKVAKINWHYADSLTQCSHPSAIDPEAIPVKLVHDSLEDLQMTRYHFAMNGKSFSVILE
HFQDLVPKLMLHGTVFARMAPDQKTQLIEALQNVDYFVGMCGDGANDCGALKRAHGGISL
SELEASVASPFTSKTPSISCVPNLIREGRAALITSFCVFKFMALYSIIQYFSVTLLYSIL
SNLGDFQFLFIDLAIILVVVFTMSLNPAWKELVAQRPPSGLISGALLFSVLSQIIICIGF
QSLGFFWVKQQPWYEVWHPKSDACNTTGSGFWNSSHVDNETELDEHNIQNYENTTVFFIS
SFQYLIVAIAFSKGKPFRQPCYKNYFFVFSVIFLYIFILFIMLYPVASVDQVLQIVCVPY
QWRVTMLIIVLVNAFVSITVEESVDRWGKCCLPWALGCRKKTPKAKYMYLAQELLVDPEW
PPKPQTTTEAKALVKENGSCQIITIT
Function ATP-driven pump involved in endocytosis-dependent polyamine transport. Uses ATP as an energy source to transfer polyamine precursor putrescine from the endosomal compartment to the cytosol.
Tissue Specificity Broadly expressed.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Pulmonary arterial hypertension DISP8ZX5 Definitive Semidominant [1]
Carcinoma DISH9F1N Strong Altered Expression [2]
Heritable pulmonary arterial hypertension DISD1Y94 Strong Biomarker [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Polyamine-transporting ATPase 13A3 (ATP13A3). [4]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Polyamine-transporting ATPase 13A3 (ATP13A3). [12]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Polyamine-transporting ATPase 13A3 (ATP13A3). [14]
------------------------------------------------------------------------------------
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Polyamine-transporting ATPase 13A3 (ATP13A3). [5]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Polyamine-transporting ATPase 13A3 (ATP13A3). [6]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Polyamine-transporting ATPase 13A3 (ATP13A3). [7]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Polyamine-transporting ATPase 13A3 (ATP13A3). [8]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Polyamine-transporting ATPase 13A3 (ATP13A3). [9]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Polyamine-transporting ATPase 13A3 (ATP13A3). [10]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Polyamine-transporting ATPase 13A3 (ATP13A3). [11]
Tamibarotene DM3G74J Phase 3 Tamibarotene affects the expression of Polyamine-transporting ATPase 13A3 (ATP13A3). [5]
Geldanamycin DMS7TC5 Discontinued in Phase 2 Geldanamycin increases the expression of Polyamine-transporting ATPase 13A3 (ATP13A3). [13]
Paraquat DMR8O3X Investigative Paraquat increases the expression of Polyamine-transporting ATPase 13A3 (ATP13A3). [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Focal aberrations indicate EYA2 and hsa-miR-375 as oncogene and tumor suppressor in cervical carcinogenesis.Genes Chromosomes Cancer. 2013 Jan;52(1):56-68. doi: 10.1002/gcc.22006. Epub 2012 Sep 14.
3 Genetics and genomics of pulmonary arterial hypertension.Eur Respir J. 2019 Jan 24;53(1):1801899. doi: 10.1183/13993003.01899-2018. Print 2019 Jan.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
6 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
9 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
10 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
11 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
12 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
13 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
14 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
15 CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.