Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5FMWHV)

DOT Name	Uncharacterized protein C16orf95 (C16ORF95)
Gene Name	C16ORF95
Related Disease	Hypoplastic left heart syndrome 1 ( )
UniProt ID	CP095_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15132
Sequence	MRASRSPPSPRRCHHHHEATGAASGAAAGGPGAGCVGLCRLALTPSAQDGRNSTFQTYKK EVCLPRHSMHPGPWAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGT TAGGSAVMSACCPSSSSSRPPTRTSYRLLQRVCCPSAS

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Hypoplastic left heart syndrome 1	DISW3OY8	Limited	Genetic Variation	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Uncharacterized protein C16orf95 (C16ORF95).	[2]
------------------------------------------------------------------------------------

References

1	Genome-wide association study of maternal and inherited effects on left-sided cardiac malformations.Hum Mol Genet. 2015 Jan 1;24(1):265-73. doi: 10.1093/hmg/ddu420. Epub 2014 Aug 18.
2	Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.