Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5I11J1)

• DOT Name: Oxidoreductase NAD-binding domain-containing protein 1 (OXNAD1)
• Synonyms: EC 1.-.-.-
• Gene Name: OXNAD1
• Related Disease: Skin cancer
• UniProt ID: OXND1_HUMAN
• EC Number: 1.-.-.-
• Pfam ID: PF00175
• Sequence:
  MACAAVMIPGLLRCSVGAIRIEAASLRLTLSTLRHLTLTSIMKSKRKTDHMERTASVLRR
  EIVSAAKVCGAASESPSVKSLRLLVADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLL
  EQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFDPQPADASRNLVLIAGGVG
  INPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFPEKIA
  CSLHVTKQTTQINAELKPYITEGRITEKEIRDHISKETLFYICGPPPMTDFFSKQLENNH
  VPKEHICFEKWW

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Skin cancer	DISTM18U	Limited	Genetic Variation	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Oxidoreductase NAD-binding domain-containing protein 1 (OXNAD1).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Oxidoreductase NAD-binding domain-containing protein 1 (OXNAD1).	[8]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Oxidoreductase NAD-binding domain-containing protein 1 (OXNAD1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Oxidoreductase NAD-binding domain-containing protein 1 (OXNAD1).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Oxidoreductase NAD-binding domain-containing protein 1 (OXNAD1).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Oxidoreductase NAD-binding domain-containing protein 1 (OXNAD1).	[6]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Oxidoreductase NAD-binding domain-containing protein 1 (OXNAD1).	[7]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Oxidoreductase NAD-binding domain-containing protein 1 (OXNAD1).	[9]
CH-223191	DMMJZYC	Investigative	CH-223191 increases the expression of Oxidoreductase NAD-binding domain-containing protein 1 (OXNAD1).	[10]

References

• [1] Frequent DPH3 promoter mutations in skin cancers.Oncotarget. 2015 Nov 3;6(34):35922-30. doi: 10.18632/oncotarget.5771.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [10] Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.