Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5I6T8G)

• DOT Name: POU class 2 homeobox associating factor 3 (POU2AF3)
• Synonyms: Cancer susceptibility candidate protein 13; Colorectal cancer-associated protein 2; Protein OCA-T2
• Gene Name: POU2AF3
• UniProt ID: OCAT2_HUMAN
• Sequence:
  MSEKPKVYQGVRVKITVKELLQQRRAHQAASGGTRSGGSSVHLSDPVAPSSAGLYFEPEP
  ISSTPNYLQRGEFSSCVSCEENSSCLDQIFDSYLQTEMHPEPLLNSTQSAPHHFPDSFQA
  TPFCFNQSLIPGSPSNSSILSGSLDYSYSPVQLPSYAPENYNSPASLDTRTCGYPPEDHS
  YQHLSSHAQYSCFSSATTSICYCASCEAEDLDALQAAEYFYPSTDCVDFAPSAAATSDFY
  KRETNCDICYS
• Function: Transcriptional coactivator that specifically associates with POU2F3. This complex drives the development of tuft cells, a rare a rare chemosensory cells that coordinate immune and neural functions within mucosal epithelial tissues.
• Tissue Specificity: Expressed in many cell types of epithelial, mesenchymal and hematopoietic origins . Expressed in tufs cells .

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of POU class 2 homeobox associating factor 3 (POU2AF3).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of POU class 2 homeobox associating factor 3 (POU2AF3).	[9]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of POU class 2 homeobox associating factor 3 (POU2AF3).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of POU class 2 homeobox associating factor 3 (POU2AF3).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of POU class 2 homeobox associating factor 3 (POU2AF3).	[4]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of POU class 2 homeobox associating factor 3 (POU2AF3).	[5]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of POU class 2 homeobox associating factor 3 (POU2AF3).	[6]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of POU class 2 homeobox associating factor 3 (POU2AF3).	[7]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of POU class 2 homeobox associating factor 3 (POU2AF3).	[7]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of POU class 2 homeobox associating factor 3 (POU2AF3).	[8]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde decreases the expression of POU class 2 homeobox associating factor 3 (POU2AF3).	[10]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [6] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [7] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [8] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [9] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [10] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.