Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT5Z8ERW)
| DOT Name | Islet amyloid polypeptide (IAPP) | ||||
|---|---|---|---|---|---|
| Synonyms | Amylin; Diabetes-associated peptide; DAP; Insulinoma amyloid peptide | ||||
| Gene Name | IAPP | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| PDB ID | |||||
| Pfam ID | |||||
| Sequence | 
                        MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAIL SSTNVGSNTYGKRNAVEVLKREPLNYLPL | ||||
| Function | Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| This DOT Affected the Regulation of Drug Effects of 1 Drug(s) 
 | |||||||||||||||||||||||||||||||||||
| This DOT Affected the Drug Response of 2 Drug(s) 
 | |||||||||||||||||||||||||||||||||||
| 3 Drug(s) Affected the Gene/Protein Processing of This DOT 
 | |||||||||||||||||||||||||||||||||||
| 1 Drug(s) Affected the Post-Translational Modifications of This DOT 
 | |||||||||||||||||||||||||||||||||||
References
