Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6318BT)

DOT Name Mitotic-spindle organizing protein 2A (MZT2A)
Synonyms Mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2A
Gene Name MZT2A
UniProt ID
MZT2A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
6X0V
Pfam ID
PF12926
Sequence
MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGGIDPDVFKILV
DLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRDKGSAALGGVLA
LAERSNHEGSSQRMPRQPSATRLPKGGGPGKSPTQGST
Reactome Pathway
Recruitment of NuMA to mitotic centrosomes (R-HSA-380320 )
Recruitment of mitotic centrosome proteins and complexes (R-HSA-380270 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Mitotic-spindle organizing protein 2A (MZT2A). [1]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Mitotic-spindle organizing protein 2A (MZT2A). [2]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Mitotic-spindle organizing protein 2A (MZT2A). [3]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Mitotic-spindle organizing protein 2A (MZT2A). [4]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Mitotic-spindle organizing protein 2A (MZT2A). [5]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
3 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
4 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
5 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.