Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT69B0D9)

• DOT Name: Putative ribosome-binding factor A, mitochondrial (RBFA)
• Gene Name: RBFA
• Related Disease: Autism spectrum disorder
• UniProt ID: RBFA_HUMAN
• PDB ID: 2E7G; 7PNX; 7PNY; 7PNZ; 7PO0; 7X9U; 8CSR; 8CSS; 8CST; 8CSU
• Pfam ID: PF02033
• Sequence:
  MWAAAGGLWRSRAGLRALFRSRDAALFPGCERGLHCSAVSCKNWLKKFASKTKKKVWYES
  PSLGSHSTYKPSKLEFLMRSTSKKTRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDL
  NVELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNVPPIV
  FVQDKGNAALAELDQLLAVADFGPRDERDNFVQNDFRDPDAPQPCGTTEPTTSSSLCGID
  HEALNKQIMEYKRRKDKGLGGLVWQGQVAELTTQMKKGRKRAKPRLEQDSSLKSYLSGEE
  VEDDLDLVGAPEYECYAPDTEELEAERGGGRTEDGHSCGASRE

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[1]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Putative ribosome-binding factor A, mitochondrial (RBFA).	[2]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Putative ribosome-binding factor A, mitochondrial (RBFA).	[4]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Putative ribosome-binding factor A, mitochondrial (RBFA).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Putative ribosome-binding factor A, mitochondrial (RBFA).	[3]

References

• [1] Identification of risk genes for autism spectrum disorder through copy number variation analysis in Austrian families.Neurogenetics. 2014 May;15(2):117-27. doi: 10.1007/s10048-014-0394-0. Epub 2014 Mar 19.
• [2] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [4] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [5] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.