Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6BDZ06)

DOT Name	Palmitoyl-protein thioesterase ABHD10, mitochondrial (ABHD10)
Synonyms	EC 3.1.2.22; Acyl-protein thioesterase ABHD10; Alpha/beta hydrolase domain-containing protein 10; Abhydrolase domain-containing protein 10; Mycophenolic acid acyl-glucuronide esterase, mitochondrial; EC 3.1.1.93
Gene Name	ABHD10
UniProt ID	ABHDA_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	3.1.1.93; 3.1.2.22
Pfam ID	PF00561
Sequence	MAVARLAAVAAWVPCRSWGWAAVPFGPHRGLSVLLARIPQRAPRWLPACRQKTSLSFLNR PDLPNLAYKKLKGKSPGIIFIPGYLSYMNGTKALAIEEFCKSLGHACIRFDYSGVGSSDG NSEESTLGKWRKDVLSIIDDLADGPQILVGSSLGGWLMLHAAIARPEKVVALIGVATAAD TLVTKFNQLPVELKKEVEMKGVWSMPSKYSEEGVYNVQYSFIKEAEHHCLLHSPIPVNCP IRLLHGMKDDIVPWHTSMQVADRVLSTDVDVILRKHSDHRMREKADIQLLVYTIDDLIDK LSTIVN
Function	Acts as an acyl-protein thioesterase that hydrolyzes fatty acids from acylated residues in proteins. Regulates the mitochondrial S-depalmitoylation of the nucleophilic active site residue of peroxiredoxin-5/PRDX5, a key antioxidant protein, therefore modulating mitochondrial antioxidant ability. Also catalyzes the deglucuronidation of mycophenolic acid acyl-glucuronide, an active metabolite of the immunosuppressant drug mycophenolate.
Reactome Pathway	Glucuronidation (R-HSA-156588 )
BioCyc Pathway	MetaCyc:ENSG00000144827-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Palmitoyl-protein thioesterase ABHD10, mitochondrial (ABHD10).	[1]
------------------------------------------------------------------------------------

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Palmitoyl-protein thioesterase ABHD10, mitochondrial (ABHD10).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Palmitoyl-protein thioesterase ABHD10, mitochondrial (ABHD10).	[3]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Palmitoyl-protein thioesterase ABHD10, mitochondrial (ABHD10).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Palmitoyl-protein thioesterase ABHD10, mitochondrial (ABHD10).	[5]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Palmitoyl-protein thioesterase ABHD10, mitochondrial (ABHD10).	[6]
DNCB	DMDTVYC	Phase 2	DNCB decreases the expression of Palmitoyl-protein thioesterase ABHD10, mitochondrial (ABHD10).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Palmitoyl-protein thioesterase ABHD10, mitochondrial (ABHD10).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Palmitoyl-protein thioesterase ABHD10, mitochondrial (ABHD10).	[9]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Drug(s)

References

1	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4	Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
5	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
6	The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
7	Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
8	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
9	Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.