Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6EIYYO)

DOT Name Keratin-associated protein 1-1 (KRTAP1-1)
Synonyms High sulfur keratin-associated protein 1.1; Keratin-associated protein 1.1; Keratin-associated protein 1.6; Keratin-associated protein 1.7
Gene Name KRTAP1-1
Related Disease
Gastric cancer ( )
Stomach cancer ( )
UniProt ID
KRA11_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01500
Sequence
MACCQTSFCGFPSCSTSGTCGSSCCQPSCCETSSCQPRCCETSCCQPSCCQTSFCGFPSF
STGGTCDSSCCQPSCCETSCCQPSCYQTSSCGTGCGIGGGIGYGQEGSSGAVSTRIRWCR
PDCRVEGTCLPPCCVVSCTPPSCCQLHHAEASCCRPSYCGQSCCRPVCCCYCSEPTC
Function
In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
Tissue Specificity Expressed in the middle/upper portions of the hair cortex, in the region termed the keratogenous zone.
Reactome Pathway
Keratinization (R-HSA-6805567 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Gastric cancer DISXGOUK Limited Genetic Variation [1]
Stomach cancer DISKIJSX Limited Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Keratin-associated protein 1-1 (KRTAP1-1). [2]
------------------------------------------------------------------------------------

References

1 Mitochondrial NADH Dehydrogenase Subunit 3 (MTND3) Polymorphisms are Associated with Gastric Cancer Susceptibility.Int J Med Sci. 2018 Aug 10;15(12):1329-1333. doi: 10.7150/ijms.26881. eCollection 2018.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.