Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7DSYRO)

• DOT Name: Dehydrogenase/reductase SDR family member on chromosome X (DHRSX)
• Synonyms: EC 1.1.-.-; DHRSXY; Short chain dehydrogenase/reductase family 46C member 1; Short chain dehydrogenase/reductase family 7C member 6
• Gene Name: DHRSX
• UniProt ID: DHRSX_HUMAN
• EC Number: 1.1.-.-
• Pfam ID: PF00106
• Sequence:
  MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTA
  KHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKK
  IPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVT
  VSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDP
  GVVNTDVYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGHYLYNEKET
  KSLHVTYNQKLQQQLWSKSCEMTGVLDVTL
• Function: Involved in the positive regulation of starvation-induced autophagy.
• Tissue Specificity: Widely expressed. Highly expressed in the pancreas.

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Dehydrogenase/reductase SDR family member on chromosome X (DHRSX).	[1]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Dehydrogenase/reductase SDR family member on chromosome X (DHRSX).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Dehydrogenase/reductase SDR family member on chromosome X (DHRSX).	[3]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Dehydrogenase/reductase SDR family member on chromosome X (DHRSX).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Dehydrogenase/reductase SDR family member on chromosome X (DHRSX).	[5]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Dehydrogenase/reductase SDR family member on chromosome X (DHRSX).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Dehydrogenase/reductase SDR family member on chromosome X (DHRSX).	[7]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Dehydrogenase/reductase SDR family member on chromosome X (DHRSX).	[8]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [5] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [6] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [7] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [8] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.