Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT7MCG86)
| DOT Name | Small nuclear protein PRAC1 (PRAC1) | ||||
|---|---|---|---|---|---|
| Synonyms | Prostate cancer susceptibility candidate protein 1; Prostate, rectum and colon expressed gene protein | ||||
| Gene Name | PRAC1 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Sequence |
MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP
|
||||
| Tissue Specificity | Highly expressed in prostate, rectum, and distal colon, and weakly expressed in bladder. Expressed in prostate cancer cell lines. | ||||
Molecular Interaction Atlas (MIA) of This DOT
|
3 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
2 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||||||||
|
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
||||||||||||||||||||||||||||||||||||
References
