General Information of Drug Off-Target (DOT) (ID: OT7WZRD0)

DOT Name Probable phosphoglycerate mutase 4 (PGAM4)
Synonyms EC 5.4.2.11; EC 5.4.2.4
Gene Name PGAM4
Related Disease
Male infertility ( )
UniProt ID
PGAM4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
5.4.2.11; 5.4.2.4
Pfam ID
PF00300
Sequence
MAAYKLVLIRHGESTWNLENRFSCWYDADLSPAGHEEAKRGGQALRDAGYEFDICLTSVQ
KRVIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSYESPKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLQGIAKHVEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVC
KAIEAVAAQGKAKK
KEGG Pathway
Glycolysis / Gluconeogenesis (hsa00010 )
Glycine, serine and threonine metabolism (hsa00260 )
Metabolic pathways (hsa01100 )
Carbon metabolism (hsa01200 )
Biosynthesis of amino acids (hsa01230 )
Glucagon sig.ling pathway (hsa04922 )
Central carbon metabolism in cancer (hsa05230 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Male infertility DISY3YZZ Strong Altered Expression [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Probable phosphoglycerate mutase 4 (PGAM4). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Probable phosphoglycerate mutase 4 (PGAM4). [7]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Probable phosphoglycerate mutase 4 (PGAM4). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Probable phosphoglycerate mutase 4 (PGAM4). [4]
Marinol DM70IK5 Approved Marinol decreases the expression of Probable phosphoglycerate mutase 4 (PGAM4). [5]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Probable phosphoglycerate mutase 4 (PGAM4). [6]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of Probable phosphoglycerate mutase 4 (PGAM4). [8]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Probable phosphoglycerate mutase 4 (PGAM4). [9]
chloropicrin DMSGBQA Investigative chloropicrin decreases the expression of Probable phosphoglycerate mutase 4 (PGAM4). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 A single nucleotide polymorphism within the novel sex-linked testis-specific retrotransposed PGAM4 gene influences human male fertility.PLoS One. 2012;7(5):e35195. doi: 10.1371/journal.pone.0035195. Epub 2012 May 9.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
6 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
7 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
8 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
9 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
10 Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.