General Information of Drug Off-Target (DOT) (ID: OT848HC4)

DOT Name Transmembrane protein 141 (TMEM141)
Gene Name TMEM141
UniProt ID
TM141_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2LOR
Pfam ID
PF15110
Sequence
MVNLGLSRVDDAVAAKHPGLGEYAACQSHAFMKGVFTFVTGTGMAFGLQMFIQRKFPYPL
QWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Transmembrane protein 141 (TMEM141). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Transmembrane protein 141 (TMEM141). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Transmembrane protein 141 (TMEM141). [3]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Transmembrane protein 141 (TMEM141). [4]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Transmembrane protein 141 (TMEM141). [5]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Transmembrane protein 141 (TMEM141). [6]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Transmembrane protein 141 (TMEM141). [2]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Transmembrane protein 141 (TMEM141). [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
6 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
7 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.