Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT88097H)

DOT Name	Pre-mRNA-splicing factor 38A (PRPF38A)
Gene Name	PRPF38A
UniProt ID	PR38A_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	4RZ9; 4RZA; 5F5S; 5O9Z; 6AHD; 7AAV; 7ABF; 7ABG; 7ABI
Pfam ID	PF03371 ; PF12871
Sequence	MANRTVKDAHSIHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELRFVGGV YGGNIKPTPFLCLTLKMLQIQPEKDIIVEFIKNEDFKYVRMLGALYMRLTGTAIDCYKYL EPLYNDYRKIKSQNRNGEFELMHVDEFIDELLHSERVCDIILPRLQKRYVLEEAEQLEPR VSALEEDMDDVESSEEEEEEDEKLERVPSPDHRRRSYRDLDKPRRSPTLRYRRSRSRSPR RRSRSPKRRSPSPRRERHRSKSPRRHRSRSRDRRHRSRSKSPGHHRSHRHRSHSKSPERS KKSHKKSRRGNE
Function	Involved in pre-mRNA splicing as a component of the spliceosome.
KEGG Pathway	Spliceosome (hsa03040 )
Reactome Pathway	mRNA Splicing - Major Pathway (R-HSA-72163 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Pre-mRNA-splicing factor 38A (PRPF38A).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Pre-mRNA-splicing factor 38A (PRPF38A).	[2]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Pre-mRNA-splicing factor 38A (PRPF38A).	[3]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Pre-mRNA-splicing factor 38A (PRPF38A).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Pre-mRNA-splicing factor 38A (PRPF38A).	[5]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Pre-mRNA-splicing factor 38A (PRPF38A).	[6]
Aminohippuric acid	DMUN54G	Investigative	Aminohippuric acid affects the expression of Pre-mRNA-splicing factor 38A (PRPF38A).	[7]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Drug(s)

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Pre-mRNA-splicing factor 38A (PRPF38A).	[4]
------------------------------------------------------------------------------------

References

1	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
2	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3	Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
4	Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
5	Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
6	Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
7	Identification of molecular signatures predicting the carcinogenicity of polycyclic aromatic hydrocarbons (PAHs). Toxicol Lett. 2012 Jul 7;212(1):18-28. doi: 10.1016/j.toxlet.2012.04.013. Epub 2012 May 1.