Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8KLVET)

• DOT Name: Small ribosomal subunit protein mS37 (CHCHD1)
• Synonyms: 28S ribosomal protein S37, mitochondrial; MRP-S37; Coiled-coil-helix-coiled-coil-helix domain-containing protein 1; Nuclear protein C2360
• Gene Name: CHCHD1
• UniProt ID: CHCH1_HUMAN
• PDB ID: 3J9M; 6NU2; 6NU3; 6RW4; 6RW5; 6VLZ; 6VMI; 6ZM5; 6ZM6; 6ZS9; 6ZSA; 6ZSB; 6ZSC; 6ZSD; 6ZSE; 6ZSG; 7A5F; 7A5G; 7A5I; 7A5K; 7L08; 7OG4; 7P2E; 7PO1; 7PO2; 7PO3; 7QI4; 7QI5; 7QI6; 8ANY; 8OIR; 8OIS
• Pfam ID: PF06747
• Sequence:
  MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNE
  FRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS
• Reactome Pathway:
  Mitochondrial translation elongation (R-HSA-5389840)
  Mitochondrial translation termination (R-HSA-5419276)
  Mitochondrial translation initiation (R-HSA-5368286)

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Small ribosomal subunit protein mS37 (CHCHD1).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Small ribosomal subunit protein mS37 (CHCHD1).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Small ribosomal subunit protein mS37 (CHCHD1).	[3]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Small ribosomal subunit protein mS37 (CHCHD1).	[4]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Small ribosomal subunit protein mS37 (CHCHD1).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Small ribosomal subunit protein mS37 (CHCHD1).	[7]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Small ribosomal subunit protein mS37 (CHCHD1).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Small ribosomal subunit protein mS37 (CHCHD1).	[6]

References

• [1] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [2] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Epigallocatechin-3-gallate (EGCG) protects against chromate-induced toxicity in vitro. Toxicol Appl Pharmacol. 2012 Jan 15;258(2):166-75.
• [5] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
• [8] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.