Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8RWHN3)

• DOT Name: Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3)
• Synonyms: Serologically defined breast cancer antigen NY-BR-84
• Gene Name: ERGIC3
• Related Disease:
  Lung adenocarcinoma
  Neoplasm
  Non-small-cell lung cancer
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Precancerous condition
• UniProt ID: ERGI3_HUMAN
• Pfam ID: PF07970 ; PF13850
• Sequence:
  MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYV
  DKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAE
  RHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIE
  QCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNI
  NMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQF
  SVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAG
  LIDSLIYHSARAIQKKIDLGKTT
• Function: Possible role in transport between endoplasmic reticulum and Golgi. Positively regulates trafficking of the secretory proteins SERPINA1/alpha1-antitrypsin and HP/haptoglobin.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[1]
Neoplasm	DISZKGEW	Strong	Altered Expression	[2]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[3]
Lung cancer	DISCM4YA	Limited	Altered Expression	[4]
Lung carcinoma	DISTR26C	Limited	Altered Expression	[4]
Lung neoplasm	DISVARNB	Limited	Biomarker	[3]
Precancerous condition	DISV06FL	Limited	Biomarker	[3]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3).	[5]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3).	[9]
Selenium	DM25CGV	Approved	Selenium increases the expression of Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3).	[10]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3).	[12]
GALLICACID	DM6Y3A0	Investigative	GALLICACID increases the expression of Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3).	[13]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3).	[14]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3).	[8]

References

• [1] Suppression subtractive hybridization identified differentially expressed genes in lung adenocarcinoma: ERGIC3 as a novel lung cancer-related gene.BMC Cancer. 2013 Feb 1;13:44. doi: 10.1186/1471-2407-13-44.
• [2] ERGIC3, which is regulated by miR-203a, is a potential biomarker for non-small cell lung cancer.Cancer Sci. 2015 Oct;106(10):1463-73. doi: 10.1111/cas.12741. Epub 2015 Aug 10.
• [3] Endoplasmic reticulum-Golgi intermediate compartment protein 3 knockdown suppresses lung cancer through endoplasmic reticulum stress-induced autophagy.Oncotarget. 2016 Oct 4;7(40):65335-65347. doi: 10.18632/oncotarget.11678.
• [4] ERGIC3 Silencing Additively Enhances the Growth Inhibition of BFA on Lung Adenocarcinoma Cells.Curr Cancer Drug Targets. 2020;20(1):67-75. doi: 10.2174/1568009619666190917145906.
• [5] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [6] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [9] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [10] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [11] Benzo[a]pyrene increases the Nrf2 content by downregulating the Keap1 message. Toxicol Sci. 2010 Aug;116(2):549-61.
• [12] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [13] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
• [14] Analysis of the prostate cancer cell line LNCaP transcriptome using a sequencing-by-synthesis approach. BMC Genomics. 2006 Sep 29;7:246. doi: 10.1186/1471-2164-7-246.