Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8TI57X)

DOT Name	Alpha-(1,3)-fucosyltransferase 10 (FUT10)
Synonyms	EC 2.4.1.-; Fucosyltransferase X; Fuc-TX; FucT-X; Galactoside 3-L-fucosyltransferase 10; Fucosyltransferase 10
Gene Name	FUT10
UniProt ID	FUT10_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	2.4.1.-
Pfam ID	PF17039 ; PF00852
Sequence	MVRIQRRKLLASCLCVTATVFLLVTLQVMVELGKFERKEFKSSSLQDGHTKMEEAPTHLN SFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHMTK AFLFYGTDFNIDSLPLPRKAHHDWAVFHEESPKNNYKLFHKPVITLFNYTATFSRHSHLP LTTQYLESIEVLKSLRYLVPLQSKNKLRKRLAPLVYVQSDCDPPSDRDSYVRELMTYIEV DSYGECLRNKDLPQQLKNPASMDADGFYRIIAQYKFILAFENAVCDDYITEKFWRPLKLG VVPVYYGSPSITDWLPSNKSAILVSEFSHPRELASYIRRLDSDDRLYEAYVEWKLKGEIS NQRLLTALRERKWGVQDVNQDNYIDAFECMVCTKVWANIRLQEKGLPPKRWEAEDTHLSC PEPTVFAFSPLRTPPLSSLREMWISSFEQSKKEAQALRWLVDRNQNFSSQEFWGLVFKD
Function	Predominantly fucosylates the innermost N-acetyl glucosamine (GlcNAc) residue in biantennary N-glycan acceptors. Postulated to generate core alpha(1->3)-fucose epitope within the chitobiose unit of biantennary N-glycans, providing for a recognition signal to reorient aberrantly folded glycoproteins for degradation. Involved in biosynthesis of Lewis X-carrying biantennary N-glycans that regulate neuron stem cell self-renewal during brain development; [Isoform 1]: Catalyzes the transfer of fucosyl moiety from GDP-beta-L-fucose to the innermost GlcNAc residue in biantennary N-glycan acceptors. Does not fucosylate GlcNAc within type 2 lactosamine unit; [Isoform 4]: Catalyzes the transfer of fucosyl moiety from GDP-beta-L-fucose to the innermost GlcNAc residue in biantennary N-glycan acceptors. Does not fucosylate GlcNAc within type 2 lactosamine unit; [Isoform 5]: Catalyzes the transfer of fucosyl moiety from GDP-beta-L-fucose to the innermost GlcNAc residue in biantennary N-glycan acceptors. Does not fucosylate GlcNAc within type 2 lactosamine unit.
Tissue Specificity	Expressed in lung, digestive tract, gall bladder, placenta, kidney, uterus and brain. Not detected in spleen, heart, muscle, liver and pancreas.
Reactome Pathway	Lewis blood group biosynthesis (R-HSA-9037629 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Alpha-(1,3)-fucosyltransferase 10 (FUT10).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Alpha-(1,3)-fucosyltransferase 10 (FUT10).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Alpha-(1,3)-fucosyltransferase 10 (FUT10).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Alpha-(1,3)-fucosyltransferase 10 (FUT10).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Alpha-(1,3)-fucosyltransferase 10 (FUT10).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Alpha-(1,3)-fucosyltransferase 10 (FUT10).	[6]
Melphalan	DMOLNHF	Approved	Melphalan decreases the expression of Alpha-(1,3)-fucosyltransferase 10 (FUT10).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Alpha-(1,3)-fucosyltransferase 10 (FUT10).	[8]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Drug(s)

References

1	Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
2	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
3	Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
4	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6	Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
7	Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
8	Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.