Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT93QQKE)

• DOT Name: Inactive polypeptide N-acetylgalactosaminyltransferase-like protein 5 (GALNTL5)
• Synonyms: Polypeptide GalNAc transferase 15; GalNAc-T15; pp-GaNTase 15; Protein-UDP acetylgalactosaminyltransferase 15; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 15
• Gene Name: GALNTL5
• Related Disease:
  Gastric adenocarcinoma
  Male infertility
  Skin disease
• UniProt ID: GLTL5_HUMAN
• Pfam ID: PF00535
• Sequence:
  MRNAIIQGLFYGSLTFGIWTALLFIYLHHNHVSSWQKKSQEPLSAWSPGKKVHQQIIYGS
  EQIPKPHVIVKRTDEDKAKSMLGTDFNHTNPELHKELLKYGFNVIISRSLGIEREVPDTR
  SKMCLQKHYPARLPTASIVICFYNEECNALFQTMSSVTNLTPHYFLEEIILVDDMSKVDD
  LKEKLDYHLETFRGKVKIIRNKKREGLIRARLIGASHASGDVLVFLDSHCEVNRVWLEPL
  LHAIAKDPKMVVCPLIDVIDDRTLEYKPSPLVRGTFDWNLQFKWDNVFSYEMDGPEGSTK
  PIRSPAMSGGIFAIRRHYFNEIGQYDKDMDFWGRENLELSLRIWMCGGQLFIIPCSRVGH
  ISKKQTGKPSTIISAMTHNYLRLVHVWLDEYKEQFFLRKPGLKYVTYGNIRERVELRKRL
  GCKSFQWYLDNVFPELEASVNSL
• Function: Probable inactive glycosyltransferase required during spermatid development. May participate in protein loading into the acrosomes and accumulation of ubiquitin-proteasome systems around the head-tail coupling apparatus region.
• Tissue Specificity: Mainly expressed in testis. Weakly or not expressed in other tissues.
• KEGG Pathway:
  Mucin type O-glycan biosynthesis (hsa00512)
  Other types of O-glycan biosynthesis (hsa00514)
  Metabolic pathways (hsa01100)
• Reactome Pathway: O-linked glycosylation of mucins (R-HSA-913709)

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gastric adenocarcinoma	DISWWLTC	Strong	Biomarker	[1]
Male infertility	DISY3YZZ	Strong	Genetic Variation	[2]
Skin disease	DISDW8R6	Strong	Biomarker	[3]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Inactive polypeptide N-acetylgalactosaminyltransferase-like protein 5 (GALNTL5).	[4]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Inactive polypeptide N-acetylgalactosaminyltransferase-like protein 5 (GALNTL5).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Inactive polypeptide N-acetylgalactosaminyltransferase-like protein 5 (GALNTL5).	[5]

References

• [1] GalNAc-T15 in gastric adenocarcinoma: Characterization according to tissue architecture and cellular location.Eur J Histochem. 2018 Jun 14;62(2):2931. doi: 10.4081/ejh.2018.2931.
• [2] A heterozygous mutation of GALNTL5 affects male infertility with impairment of sperm motility.Proc Natl Acad Sci U S A. 2014 Jan 21;111(3):1120-5. doi: 10.1073/pnas.1310777111. Epub 2014 Jan 7.
• [3] Association between genome-wide copy number variation and arsenic-induced skin lesions: a prospective study.Environ Health. 2017 Jul 18;16(1):75. doi: 10.1186/s12940-017-0283-8.
• [4] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.