Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT993HTH)

• DOT Name: Motile sperm domain-containing protein 1 (MOSPD1)
• Gene Name: MOSPD1
• UniProt ID: MSPD1_HUMAN
• Pfam ID: PF00635
• Sequence:
  MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKY
  VVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPS
  AKEQQKEEEEKRLKEHLTESLFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGD
  VESLVPLYLHLSVNQKLVAAYILGLITMAILRT
• Function: Plays a role in differentiation and/or proliferation of mesenchymal stem cells. Proposed to be involved in epithelial-to-mesenchymal transition (EMT). However, another study suggests that it is not required for EMT or stem cell self-renewal and acts during later stages of differentiation.

Molecular Interaction Atlas (MIA) of This DOT

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Motile sperm domain-containing protein 1 (MOSPD1).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Motile sperm domain-containing protein 1 (MOSPD1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Motile sperm domain-containing protein 1 (MOSPD1).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Motile sperm domain-containing protein 1 (MOSPD1).	[4]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Motile sperm domain-containing protein 1 (MOSPD1).	[5]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Motile sperm domain-containing protein 1 (MOSPD1).	[6]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Motile sperm domain-containing protein 1 (MOSPD1).	[7]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Motile sperm domain-containing protein 1 (MOSPD1).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Motile sperm domain-containing protein 1 (MOSPD1).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Motile sperm domain-containing protein 1 (MOSPD1).	[10]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Motile sperm domain-containing protein 1 (MOSPD1).	[6]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Motile sperm domain-containing protein 1 (MOSPD1).	[12]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Motile sperm domain-containing protein 1 (MOSPD1).	[13]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Motile sperm domain-containing protein 1 (MOSPD1).	[11]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [6] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [7] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [8] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [9] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [10] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [11] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [12] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [13] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.